RING finger protein 165 (RNF165) Recombinant Protein | RNF165 recombinant protein

Recombinant Human RING finger protein 165 (RNF165)

Cat. Num. AAA1402895

• Gene Names: RNF165; ARKL2; RNF111L2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: RING finger protein 165 (RNF165); Recombinant Human RING finger protein 165 (RNF165); RNF165 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-346, Full length protein
• Sequence: MVLVHVGYLVLPVFGSVRNRGAPFQRSQHPHATSCRHFHLGPPQPQQLAPDFPLAHPVQSQPGLSAHMAPAHQHSGALHQSLTPLPTLQFQDVTGPSFLPQALHQQYLLQQQLLEAQHRRLVSHPRRSQERVSVHPHRLHPSFDFGQLQTPQPRYLAEGTDWDLSVDAGLSPAQFQVRPIPQHYQHYLATPRMHHFPRNSSSTQMVVHEIRNYPYPQLHFLALQGLNPSRHTSAVRESYEELLQLEDRLGNVTRGAVQNTIERFTFPHKYKKRRPQDGKGKKDEGEESDTDEKCTICLSMLEDGEDVRRLPCMHLFHQLCVDQWLAMSKKCPICRVDIETQLGADS
• Sequence Length: 346

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for RNF165 recombinant protein

Encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.

NCBI and Uniprot Product Information

• NCBI GI #: 377520133
• NCBI GeneID: 494470
• NCBI Accession #: NP_001243687.1
• NCBI GenBank Nucleotide #: NM_001256758.1
• UniProt Accession #: Q6ZSG1; B3KVD1
• Molecular Weight: 17,870 Da
• NCBI Official Full Name: E3 ubiquitin-protein ligase RNF165 isoform 2
• NCBI Official Synonym Full Names: ring finger protein 165
• NCBI Official Symbol: RNF165
• NCBI Official Synonym Symbols: ARKL2; RNF111L2
• NCBI Protein Information: E3 ubiquitin-protein ligase RNF165; RING finger protein 165
• UniProt Protein Name: E3 ubiquitin-protein ligase RNF165
• Protein Family: RING finger protein
• UniProt Gene Name: RNF165

NCBI Description

Encoded in regions involved in pericentric inversions in patients with bipolar affective disorder. [provided by RefSeq, Jul 2008]

Uniprot Description

E3 ubiquitin-protein ligase that acts as a regulator of motor axon elongation. Required for efficient motor axon extension in the dorsal forelimb by enhancing the transcriptional responses of the SMAD1/SMAD5/SMAD8 effectors, which are activated downstream of BMP. Acts by mediating ubiquitination and degradation of SMAD inhibitors such as SMAD6, SMAD7, SKI and SNON isoform of SKIL.