Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

E3 ubiquitin-protein ligase RNF138 (Rnf138) Recombinant Protein | Rnf138 recombinant protein

Recombinant Rat E3 ubiquitin-protein ligase RNF138 (Rnf138)

Gene Names
Rnf138; Rsd4; Trif
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase RNF138 (Rnf138); Recombinant Rat E3 ubiquitin-protein ligase RNF138 (Rnf138); Rnf138 recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-209, full length protein
Sequence
SEELSADTSYTEDDFYCPVCQEVLKTPVRTAACQHVFCRKCFLTAMRESGIHCPLCRGSVTRRERACPERAIDLENIMRRVSGSCRCCSKKIKFYRMRHHYKSCKKYQDEYGVSSVIPNVKISQDSVRSSNRSETSASDNTETYQEDTSSSGHPTFKCPLCQESNFTRQRLLDHCNSNHLFQIVPVNLQLDEETQYQTAVEESFQVNM
Sequence Length
208
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Rnf138 recombinant protein
This protein contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-DNA and protein-protein interactions. Alternatively spliced transcript variants encoding distinct isoforms have been observed.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,072 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase RNF138
NCBI Official Synonym Full Names
ring finger protein 138
NCBI Official Symbol
Rnf138
NCBI Official Synonym Symbols
Rsd4; Trif
NCBI Protein Information
E3 ubiquitin-protein ligase RNF138
UniProt Protein Name
E3 ubiquitin-protein ligase RNF138
UniProt Gene Name
Rnf138

Uniprot Description

E3 ubiquitin-protein ligase involved in DNA damage response by promoting DNA resection and homologous recombination. Recruited to sites of double-strand breaks following DNA damage and specifically promotes double-strand break repair via homologous recombination. Two different, non-exclusive, mechanisms have been proposed. According to a report, regulates the choice of double-strand break repair by favoring homologous recombination over non-homologous end joining (NHEJ): acts by mediating ubiquitination of XRCC5/Ku80, leading to remove the Ku complex from DNA breaks, thereby promoting homologous recombination. According to another report, cooperates with UBE2Ds E2 ubiquitin ligases (UBE2D1, UBE2D2, UBE2D3 or UBE2D4) to promote homologous recombination by mediating ubiquitination of RBBP8/CtIP. Together with NLK, involved in the ubiquitination and degradation of TCF/LEF. Also exhibits auto-ubiquitination activity in combination with UBE2K. May act as a negative regulator in the Wnt/beta-catenin-mediated signaling pathway.

Similar Products

Product Notes

The Rnf138 rnf138 (Catalog #AAA1387466) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-209, full length protein. The amino acid sequence is listed below: SEELSADTSY TEDDFYCPVC QEVLKTPVRT AACQHVFCRK CFLTAMRESG IHCPLCRGSV TRRERACPER AIDLENIMRR VSGSCRCCSK KIKFYRMRHH YKSCKKYQDE YGVSSVIPNV KISQDSVRSS NRSETSASDN TETYQEDTSS SGHPTFKCPL CQESNFTRQR LLDHCNSNHL FQIVPVNLQL DEETQYQTAV EESFQVNM. It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase RNF138 (Rnf138), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual