RING finger protein 112 (RNF112) Recombinant Protein | RNF112 recombinant protein
Recombinant Human RING finger protein 112 (RNF112)
Gene Names
RNF112; BFP; ZNF179
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
RING finger protein 112 (RNF112); Recombinant Human RING finger protein 112 (RNF112); RNF112 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-631aa; full length protein
Sequence
MPRPALSVTSFCHRLGKRERKQSFMGNSGNSWSHTPFPKLELGLGPQPMAPRELPTCSIC LERLRDPISLDCGHDFCIRCFSTHRLPGCEPPCCPECRKICKQKRGLRSLGEKMKLLPQR PLPPALQETCPVRAEPLLLVRINASGGLILRMGAINRCLKHPLARDTPVCLLAVLGEQHS GKSFLLNHLLQGLPGLESGEGGRPRGGEASLQGCRWGANGLARGIWMWSHPFLLGKEGKK VAVFLVDTGDAMSPELSRETRIKLCALTTMLSSYQILSTSQELKDTDLDYLEMFVHVAEV MGKHYGMVPIQHLDLLVRDSSHPNKAGQGHVGNIFQRLSGRYPKVQELLQGKRARCCLLP APGRRRMNQGHASPGDTDDDFRHLLGAYVSDVLSAAPQHAKSRCQGYWNEGRAVARGDRR LLTGQQLAQEIKNLSGWMGRTGPGFTSPDEMAAQLHDLRKVEAAKREFEEYVRQQDVATK RIFSALRVLPDTMRNLLSTQKDAILARHGVALLCKGRDQTLEALEAELQATAKAFMDSYT MRFCGHLAAVGGAVGAGLMGLAGGVVGAGMAAAALAAEAGMVAAGAAVGATGAAVVGGGV GAGLAATVGCMEKEEDERLLEGDREPLLQEE
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for RNF112 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
68,355 Da
NCBI Official Full Name
RING finger protein 112
NCBI Official Synonym Full Names
ring finger protein 112
NCBI Official Symbol
RNF112
NCBI Official Synonym Symbols
BFP; ZNF179
NCBI Protein Information
RING finger protein 112
UniProt Protein Name
RING finger protein 112
Protein Family
UniProt Gene Name
RNF112
UniProt Synonym Gene Names
BFP; ZNF179
UniProt Entry Name
RN112_HUMAN
NCBI Description
This gene encodes a member of the RING finger protein family of transcription factors. The protein is primarily expressed in brain. The gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq, Jul 2008]
Uniprot Description
RNF112: 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Ubiquitin conjugating system; Membrane protein, multi-pass; Hydrolase
Chromosomal Location of Human Ortholog: 17p11.2
Cellular Component: cytoplasm; integral to membrane; nucleus
Molecular Function: GTP binding; GTPase activity; zinc ion binding
Biological Process: metabolic process; positive regulation of glial cell differentiation; positive regulation of neuron differentiation
Research Articles on RNF112
Similar Products
Product Notes
The RNF112 rnf112 (Catalog #AAA7028710) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-631aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the RNF112 rnf112 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPRPALSVTS FCHRLGKRER KQSFMGNSGN SWSHTPFPKL ELGLGPQPMA PRELPTCSIC LERLRDPISL DCGHDFCIRC FSTHRLPGCE PPCCPECRKI CKQKRGLRSL GEKMKLLPQR PLPPALQETC PVRAEPLLLV RINASGGLIL RMGAINRCLK HPLARDTPVC LLAVLGEQHS GKSFLLNHLL QGLPGLESGE GGRPRGGEAS LQGCRWGANG LARGIWMWSH PFLLGKEGKK VAVFLVDTGD AMSPELSRET RIKLCALTTM LSSYQILSTS QELKDTDLDY LEMFVHVAEV MGKHYGMVPI QHLDLLVRDS SHPNKAGQGH VGNIFQRLSG RYPKVQELLQ GKRARCCLLP APGRRRMNQG HASPGDTDDD FRHLLGAYVS DVLSAAPQHA KSRCQGYWNE GRAVARGDRR LLTGQQLAQE IKNLSGWMGR TGPGFTSPDE MAAQLHDLRK VEAAKREFEE YVRQQDVATK RIFSALRVLP DTMRNLLSTQ KDAILARHGV ALLCKGRDQT LEALEAELQA TAKAFMDSYT MRFCGHLAAV GGAVGAGLMG LAGGVVGAGM AAAALAAEAG MVAAGAAVGA TGAAVVGGGV GAGLAATVGC MEKEEDERLL EGDREPLLQE E. It is sometimes possible for the material contained within the vial of "RING finger protein 112 (RNF112), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
