Cytochrome b-c1 complex subunit Rieske-4, mitochondrial Recombinant Protein | RISP4 recombinant protein
Recombinant Nicotiana tabacum Cytochrome b-c1 complex subunit Rieske-4, mitochondrial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytochrome b-c1 complex subunit Rieske-4; mitochondrial; Recombinant Nicotiana tabacum Cytochrome b-c1 complex subunit Rieske-4; Recombinant Cytochrome b-c1 complex subunit Rieske-4; mitochondrial EC= 1.10.2.2; Complex III subunit 5-4 Rieske iron-sulfur protein 4; RISP4 Ubiquinol-cytochrome c reductase iron-sulfur subunit 4; RISP4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-236
Sequence
SSNSVSHAHDMGLVPDLPPTVAAIKNPTSKIVYDEHNHERYPPGDPSKRAFAYFVLTGGRFVYASLVRLLILKFVLSMSASKDVLALASLEVDLSSIEPGTTVTVKWRGKPVFIRRRTEDDINLANSVDLGSLRDPQQDAERVKSPEWLVVIGVCTHLGCIPLPNAGDFGGWFCPCHGSHYDISGRIRKGPAPYNLEVPTYSFLEENKLLIG
Sequence Length
236
Species
Nicotiana tabacum (Common tobacco)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
25,822 Da
NCBI Official Full Name
Cytochrome b-c1 complex subunit Rieske-4, mitochondrial
UniProt Protein Name
Cytochrome b-c1 complex subunit Rieske-4, mitochondrial
Protein Family
UniProt Gene Name
RISP4
UniProt Synonym Gene Names
RISP4
UniProt Entry Name
UCRI4_TOBAC
Uniprot Description
Function: Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis.
Catalytic activity: QH2 + 2 ferricytochrome c = Q + 2 ferrocytochrome c + 2 H+.
Cofactor: Binds 1 2Fe-2S cluster per subunit
By similarity.
Subunit structure: The bc1 complex contains 10 subunits; 3 respiratory subunits, 2 core proteins and 5 low-molecular weight proteins.
Subcellular location: Mitochondrion inner membrane.
Miscellaneous: The Rieske protein is a high potential 2Fe-2S protein.
Sequence similarities: Contains 1 Rieske domain.
Similar Products
Product Notes
The Cytochrome b-c1 complex subunit Rieske-4, mitochondrial risp4 (Catalog #AAA1049405) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-236. The amino acid sequence is listed below: SSNSVSHAHD MGLVPDLPPT VAAIKNPTSK IVYDEHNHER YPPGDPSKRA FAYFVLTGGR FVYASLVRLL ILKFVLSMSA SKDVLALASL EVDLSSIEPG TTVTVKWRGK PVFIRRRTED DINLANSVDL GSLRDPQQDA ERVKSPEWLV VIGVCTHLGC IPLPNAGDFG GWFCPCHGSH YDISGRIRKG PAPYNLEVPT YSFLEENKLL IG. It is sometimes possible for the material contained within the vial of "Cytochrome b-c1 complex subunit Rieske-4, mitochondrial, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
