Ribosome maturation factor RimM (rimM) Recombinant Protein | rimM recombinant protein
Recombinant Burkholderia mallei Ribosome maturation factor RimM (rimM)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ribosome maturation factor RimM (rimM); Recombinant Burkholderia mallei Ribosome maturation factor RimM (rimM); rimM recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-229, Full length protein
Sequence
MAGHDSGNAKRGRSPSFGVFVRKPVERAPAKGASDGAVDSQAIRIDAAQSWPDDAVEVGAVVDAYGLKGWVKLAAHAGAGRGGDALLKARDWWLQKGAERKFARVTQAKLHGDTVVAHPDGSVDRDTALALRGARVFVRRGDFPALAADEFYWVDLIGLDVVNEAGVALGKIADMIDNGVHSIMRVEYPATGKDGRPKTGERLIPFVGVYVKAVEQAAGRVVVDWEADY
Sequence Length
229
Species
Burkholderia mallei (strain NCTC 10247)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,430 Da
NCBI Official Full Name
MULTISPECIES: ribosome maturation factor RimM
UniProt Protein Name
Ribosome maturation factor RimM
Protein Family
UniProt Gene Name
rimM
Uniprot Description
An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.
Similar Products
Product Notes
The rimM rimm (Catalog #AAA1171425) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-229, Full length protein. The amino acid sequence is listed below: MAGHDSGNAK RGRSPSFGVF VRKPVERAPA KGASDGAVDS QAIRIDAAQS WPDDAVEVGA VVDAYGLKGW VKLAAHAGAG RGGDALLKAR DWWLQKGAER KFARVTQAKL HGDTVVAHPD GSVDRDTALA LRGARVFVRR GDFPALAADE FYWVDLIGLD VVNEAGVALG KIADMIDNGV HSIMRVEYPA TGKDGRPKTG ERLIPFVGVY VKAVEQAAGR VVVDWEADY. It is sometimes possible for the material contained within the vial of "Ribosome maturation factor RimM (rimM), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
