Ras-like GTP-binding protein rhoA (rho-1) Recombinant Protein | rho-1 recombinant protein

Recombinant Caenorhabditis elegans Ras-like GTP-binding protein rhoA (rho-1)

Cat. Num. AAA1323170

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Ras-like GTP-binding protein rhoA (rho-1); Recombinant Caenorhabditis elegans Ras-like GTP-binding protein rhoA (rho-1); rho-1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-189, Full length
• Sequence: MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPDVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVRHFCPNVPIILVGNKRDLRSDPQTVRELAKMKQEPVKPEQGRAIAEQIGAFAYLECSAKTKDGIREVFEKATQAALQQKKKKKSKC
• Sequence Length: 189

• Species: Caenorhabditis elegans
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 17541992
• NCBI GeneID: 178458
• NCBI Accession #: NP_502959.1
• NCBI GenBank Nucleotide #: NM_070558.6
• UniProt Accession #: Q22038
• Molecular Weight: 21,635 Da
• NCBI Official Full Name: Ras-like GTP-binding protein rhoA
• NCBI Official Symbol: rho-1
• NCBI Protein Information: Ras-like GTP-binding protein rhoA
• UniProt Protein Name: Ras-like GTP-binding protein rhoA
• Protein Family: Ras-like GTP-binding protein
• UniProt Gene Name: rho-1

Uniprot Description

Required for ventral migration of epidermal cells during ventral enclosure in the embryo and for cell elongation (PubMed:24016757). Also required for ventral migration of P cells during larval development (PubMed:11687661). Involved in asymmetric spindle positioning during anaphase and establishment of cell polarity during embryo development (PubMed:16921365). In adults, involved in regulation of multiple processes including locomotion, pharyngeal pumping, fecundity, ovulation, defecation and body morphology (PubMed:21387015). In body wall muscles, regulates organization of myosin thick filaments downstream of unc-89 (PubMed:18801371). Association with the oxidase bli-3 promotes ROS production and this interaction may be modulated by memo-1, in order to control the oxidative stress response and longevity (PubMed:28085666).