Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

E3 ubiquitin-protein ligase RHF1A (RHF1A) Recombinant Protein | RHF1A recombinant protein

Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase RHF1A (RHF1A)

Gene Names
RHF1A; DL3150W; FCAALL.146; RING-H2 group F1A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase RHF1A (RHF1A); Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase RHF1A (RHF1A); RHF1A recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-371, Full length protein
Sequence
MSNFTYTSAFNLSDNSPFNPAIGSSSSSSSALVVASDDDNNTDDACSICLEPFTLQDPSTVTSCKHEYHLQCIIEWSQRSKECPICWQLFVLRDPASQELLAAVEKERLLKTRNISSSSPISIHHSHDDFHSEEEESQFSSFDEQFLRHLTEAAHRRCLLRRRDGQISSSLVSSSDPTTIHPTDLVNLYRLSAISHVEHQNSNPCPSPGSMTPSPVSGHSSIPADSNNGSRISPGPSPSRSSQSPKSPEASSLPEAIKSKLAAASAKYKESISKSKQGLKEKLLARNNSVKELSKGVQREMNAGIAGVARMIERMDFSSKRFGGSAHVSTSTATASGFNFSFKGKRVEANSKSNNNGDKTEPQKLQGGETC
Sequence Length
371
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,284 Da
NCBI Official Full Name
RING-H2 group F1A
NCBI Official Symbol
RHF1A
NCBI Official Synonym Symbols
DL3150W; FCAALL.146; RING-H2 group F1A
NCBI Protein Information
RING-H2 group F1A
UniProt Protein Name
E3 ubiquitin-protein ligase RHF1A
UniProt Gene Name
RHF1A

NCBI Description

encodes a RING-type E3 ubiquitin ligase implicated in gametogenesis. RHF1a can interact with the cell cycle inhibitor ICK4/KRP6 in vitro. It apppears to target ICK4KRP6 for degradation following meiosis in order to allow the mitoses associated with megagametogenesis and microgametogenesis to occur. RHF1a is expressed in the carpels throughout floral development. It is expressed in various tissues of the anthers during the early stages of anther development but not in stage 12 flowers and beyond.

Uniprot Description

E3 ubiquitin-protein ligase involved in the positive regulation of the gametogenesis progression. Mediates the proteasomal degradation of KRP6, a cyclin-dependent kinase inhibitor which accumulates during meiosis and blocks the progression of subsequent mitoses during gametophyte development. Functions in association with RHF2A (PubMed:18552199). Possesses E3 ubiquitin-protein ligase activity when associated with the E2 enzyme UBC8 in vitro (PubMed:15644464).

Similar Products

Product Notes

The RHF1A rhf1a (Catalog #AAA1464947) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-371, Full length protein. The amino acid sequence is listed below: MSNFTYTSAF NLSDNSPFNP AIGSSSSSSS ALVVASDDDN NTDDACSICL EPFTLQDPST VTSCKHEYHL QCIIEWSQRS KECPICWQLF VLRDPASQEL LAAVEKERLL KTRNISSSSP ISIHHSHDDF HSEEEESQFS SFDEQFLRHL TEAAHRRCLL RRRDGQISSS LVSSSDPTTI HPTDLVNLYR LSAISHVEHQ NSNPCPSPGS MTPSPVSGHS SIPADSNNGS RISPGPSPSR SSQSPKSPEA SSLPEAIKSK LAAASAKYKE SISKSKQGLK EKLLARNNSV KELSKGVQRE MNAGIAGVAR MIERMDFSSK RFGGSAHVST STATASGFNF SFKGKRVEAN SKSNNNGDKT EPQKLQGGET C. It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase RHF1A (RHF1A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.