Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Regulator of G-protein signaling 5 (RGS5) Recombinant Protein | RGS5 recombinant protein

Recombinant Human Regulator of G-protein signaling 5 (RGS5)

Gene Names
RGS5; MST092; MST106; MST129; MSTP032; MSTP092; MSTP106; MSTP129
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Regulator of G-protein signaling 5 (RGS5); Recombinant Human Regulator of G-protein signaling 5 (RGS5); Regulator of G-protein signaling 5; RGS5; RGS5 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-181aa; Full Length
Sequence
MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK
Sequence Length
181
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for RGS5 recombinant protein
Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G(i)-alpha and G(o)-alpha, but not to G(s)-alpha
Product Categories/Family for RGS5 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47.9 kDa
NCBI Official Full Name
regulator of G-protein signaling 5 isoform 2
NCBI Official Synonym Full Names
regulator of G-protein signaling 5
NCBI Official Symbol
RGS5
NCBI Official Synonym Symbols
MST092; MST106; MST129; MSTP032; MSTP092; MSTP106; MSTP129
NCBI Protein Information
regulator of G-protein signaling 5
UniProt Protein Name
Regulator of G-protein signaling 5
UniProt Gene Name
RGS5
UniProt Synonym Gene Names
RGS5
UniProt Entry Name
RGS5_HUMAN

NCBI Description

This gene encodes a member of the regulators of G protein signaling (RGS) family. The RGS proteins are signal transduction molecules which are involved in the regulation of heterotrimeric G proteins by acting as GTPase activators. This gene is a hypoxia-inducible factor-1 dependent, hypoxia-induced gene which is involved in the induction of endothelial apoptosis. This gene is also one of three genes on chromosome 1q contributing to elevated blood pressure. Alternatively spliced transcript variants have been identified. [provided by RefSeq, Dec 2011]

Uniprot Description

RGS5: Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G(i)-alpha and G(o)-alpha, but not to G(s)-alpha. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: GAPs; GAPs, RGS

Chromosomal Location of Human Ortholog: 1q23.1

Cellular Component: cytoplasm; plasma membrane

Molecular Function: GTPase activator activity

Biological Process: signal transduction; regulation of G-protein coupled receptor protein signaling pathway; positive regulation of GTPase activity

Disease: Hypertension, Essential

Research Articles on RGS5

Similar Products

Product Notes

The RGS5 rgs5 (Catalog #AAA1199589) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-181aa; Full Length. The amino acid sequence is listed below: MCKGLAALPH SCLERAKEIK IKLGILLQKP DSVGDLVIPY NEKPEKPAKT QKTSLDEALQ WRDSLDKLLQ NNYGLASFKS FLKSEFSEEN LEFWIACEDY KKIKSPAKMA EKAKQIYEEF IQTEAPKEVN IDHFTKDITM KNLVEPSLSS FDMAQKRIHA LMEKDSLPRF VRSEFYQELI K. It is sometimes possible for the material contained within the vial of "Regulator of G-protein signaling 5 (RGS5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.