Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Gingipain R2 (rgpB) Recombinant Protein | rgpB recombinant protein

Recombinant Porphyromonas gingivalis Gingipain R2 (rgpB), partial

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Gingipain R2 (rgpB); Recombinant Porphyromonas gingivalis Gingipain R2 (rgpB); partial; Arg-gingipain; Gingipain 2; RGP-2; rgpB recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
230-473aa; partial
Sequence
YTPVEEKENGRMIVIVPKKYEEDIEDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDKWLGQALCIASAEGGPSADNGESDIQHENIIANLLTQYGYTKIIKCYDPGVTPKNIIDAFNGGISLANYTGHGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVAC
Species
Porphyromonas gingivalis (strain # BAA-308 / W83)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for rgpB recombinant protein
Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Its proteolytic activity is a major factor in both periodontal tissue destruction and in bacterial host defense mechanisms. Activates complement C3 and C5
References
"Comparative properties of two cysteine proteinases (gingipains R), the products of two related but individual genes of Porphyromonas gingivalis." Potempa J., Mikolajczyk-Pawlinska J., Brassell D., Nelson D., Thoegersen I.B., Enghild J.J., Travis J. J. Biol. Chem. 273:21648-21657(1998)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43.3 kDa
NCBI Official Full Name
gingipain R2
NCBI Official Symbol
PG_RS02240
NCBI Protein Information
gingipain R2
UniProt Protein Name
Gingipain R2
UniProt Gene Name
rgpB
UniProt Synonym Gene Names
prtRII; rgp2
UniProt Entry Name
CPG2_PORGI

Similar Products

Product Notes

The rgpB rgpb (Catalog #AAA18598) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 230-473aa; partial. The amino acid sequence is listed below: YTPVEEKENG RMIVIVPKKY EEDIEDFVDW KNQRGLRTEV KVAEDIASPV TANAIQQFVK QEYEKEGNDL TYVLLVGDHK DIPAKITPGI KSDQVYGQIV GNDHYNEVFI GRFSCESKED LKTQIDRTIH YERNITTEDK WLGQALCIAS AEGGPSADNG ESDIQHENII ANLLTQYGYT KIIKCYDPGV TPKNIIDAFN GGISLANYTG HGSETAWGTS HFGTTHVKQL TNSNQLPFIF DVAC . It is sometimes possible for the material contained within the vial of "Gingipain R2 (rgpB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.