Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

UDP-arabinopyranose mutase 3 (RGP3) Recombinant Protein | RGP3 recombinant protein

Recombinant Arabidopsis thaliana UDP-arabinopyranose mutase 3 (RGP3)

Gene Names
RGP3; reversibly glycosylated polypeptide 3; RGP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
UDP-arabinopyranose mutase 3 (RGP3); Recombinant Arabidopsis thaliana UDP-arabinopyranose mutase 3 (RGP3); RGP3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-362, Full length protein
Sequence
MAQLYSSVKPTPMLKDELDIVIPTIRNLDFLEMWRPFFEQYHLIIVQDGDPSKVINIPVGFDYELYNRNDINRILGPKASCISFKDSACRCFGYMVSKKKYIYTIDDDCFVAKDPTGKEINALEQHIKNLLSPSTPHFFNTLYDPYRDGADFVRGYPFSMREGAITAVSHGLWLNIPDYDAPTQLVKPLEKNSRYVDAVMTIPKGTLFPMCGMNLAFDRELIGPAMYFGLMGDGQPIGRYDDMWAGWCVKVICDHMGWGVKTGLPYIWHSKASNPFVNLKKEYNGIFWQEEAIPFFQSVTLPKECTSVQQCYLELAKLVREKLGKVDPYFITLATGMVTWIEAWEELNSAEGTEAEAPKGKN
Sequence Length
362
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,282 Da
NCBI Official Full Name
reversibly glycosylated polypeptide 3
NCBI Official Symbol
RGP3
NCBI Official Synonym Symbols
reversibly glycosylated polypeptide 3; RGP
NCBI Protein Information
reversibly glycosylated polypeptide 3
UniProt Protein Name
UDP-arabinopyranose mutase 3
UniProt Gene Name
RGP3
UniProt Synonym Gene Names
AtRGP3

NCBI Description

RGP3 is a UDP-arabinose mutase that catalyzes the interconversion between the pyranose and furanose forms of UDP-L-arabinose. It is a reversibly autoglycosylated protein. Fluorescently-tagged RGP3 is found in the cytosol and associated with Golgi-like particles when expressed in tobacco leaves. An RGP3-YFP fusion protein under the control a native promoter can be found in the endosperm of Arabidopsis embryos during the linear and bent cotyledon stages of development.

Uniprot Description

UDP-L-arabinose mutase involved in the biosynthesis of cell wall non-cellulosic polysaccharides. Catalyzes the interconvertion of UDP-L-arabinopyranose (UDP-Arap) and UDP-L-arabinofuranose (UDP-Araf). Preferentially catalyzes the formation of UDP-Arap from UDP-Araf. At thermodynamic equilibrium in vitro the ratio of the pyranose form over the furanose form is 95:5. Is not active on other UDP-sugars (UDP-Gal, UDP-Xyl, UDP-Glc, GDP-Man and GDP-Fuc). Is probably active as heteromer in vivo.

Similar Products

Product Notes

The RGP3 rgp3 (Catalog #AAA1213540) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-362, Full length protein. The amino acid sequence is listed below: MAQLYSSVKP TPMLKDELDI VIPTIRNLDF LEMWRPFFEQ YHLIIVQDGD PSKVINIPVG FDYELYNRND INRILGPKAS CISFKDSACR CFGYMVSKKK YIYTIDDDCF VAKDPTGKEI NALEQHIKNL LSPSTPHFFN TLYDPYRDGA DFVRGYPFSM REGAITAVSH GLWLNIPDYD APTQLVKPLE KNSRYVDAVM TIPKGTLFPM CGMNLAFDRE LIGPAMYFGL MGDGQPIGRY DDMWAGWCVK VICDHMGWGV KTGLPYIWHS KASNPFVNLK KEYNGIFWQE EAIPFFQSVT LPKECTSVQQ CYLELAKLVR EKLGKVDPYF ITLATGMVTW IEAWEELNSA EGTEAEAPKG KN. It is sometimes possible for the material contained within the vial of "UDP-arabinopyranose mutase 3 (RGP3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.