Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Apolipophorins (Rfabg) Recombinant Protein | Rfabg recombinant protein

Recombinant Drosophila melanogaster Apolipophorins (Rfabg), partial

Gene Names
apolpp; ApoL1; ApoL2; apoLI; ApoLI; apoLII; ApoLII; apoLpp; apoLPP; CG11064; chr4:1088013..1088173; DmelCG11064; DRBP; lipophorin; Lipophorin; Lpp; rfabg; Rfabg; RFABG; Rfabp; RfaBp; RfaBP; RFABP; RFBP; T3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Apolipophorins (Rfabg); Recombinant Drosophila melanogaster Apolipophorins (Rfabg); partial; Rfabg recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2778-2991. Partial,include VWFD Domain
Sequence
WIFFNDFELRGHVVDGKHIFTFDGLNFAYPGNCKYILAQDSVDNNFTIIGQLTNGKLKSITLIDREGSYFEVADNLALKLNGNLVEYPQHLSGLHAWRRFYTIHLYSEYGVGIVCTSDLKVCHININGFYTSKTRGLLGNGNAEPYDDFLLIDGTLAENSAALGNDYGVGKCTAIEFDNNQFKSSKRQEMCSELFGIESTLAFNFITLDSRPYR
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
372,677 Da
NCBI Official Full Name
apolipophorin, isoform B
NCBI Official Synonym Full Names
apolipophorin
NCBI Official Symbol
apolpp
NCBI Official Synonym Symbols
ApoL1; ApoL2; apoLI; ApoLI; apoLII; ApoLII; apoLpp; apoLPP; CG11064; chr4:1088013..1088173; DmelCG11064; DRBP; lipophorin; Lipophorin; Lpp; rfabg; Rfabg; RFABG; Rfabp; RfaBp; RfaBP; RFABP; RFBP; T3
NCBI Protein Information
CG11064 gene product from transcript CG11064-RC
UniProt Protein Name
Apolipophorins
UniProt Gene Name
Rfabg
UniProt Synonym Gene Names
RfaBp

Uniprot Description

Constitutes the major component of lipophorin, which mediates transport for various types of lipids in hemolymph. Acts by forming lipoprotein particles that bind lipoproteins and lipids. Also involved in the transport of hydrophobic ligands like juvenile hormones, pheromone hydrocarbons and carotenoids. Required for morphogens wingless (wg) and hedgehog (hh) function, probably by acting as vehicles for the movement of wg and hh, explaining how covalently lipidated wg and hh can spread over long distances. May also be involved in transport and/or metabolism of heme.

Research Articles on Rfabg

Similar Products

Product Notes

The Rfabg rfabg (Catalog #AAA1449145) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2778-2991. Partial,include VWFD Domain. The amino acid sequence is listed below: WIFFNDFELR GHVVDGKHIF TFDGLNFAYP GNCKYILAQD SVDNNFTIIG QLTNGKLKSI TLIDREGSYF EVADNLALKL NGNLVEYPQH LSGLHAWRRF YTIHLYSEYG VGIVCTSDLK VCHININGFY TSKTRGLLGN GNAEPYDDFL LIDGTLAENS AALGNDYGVG KCTAIEFDNN QFKSSKRQEM CSELFGIEST LAFNFITLDS RPYR . It is sometimes possible for the material contained within the vial of "Apolipophorins (Rfabg), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.