Replication initiator 1 (REPIN1) Recombinant Protein | REPIN1 recombinant protein
Recombinant Human Replication initiator 1 (REPIN1)
Gene Names
REPIN1; AP4; RIP60; ZNF464; Zfp464
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Replication initiator 1 (REPIN1); Recombinant Human Replication initiator 1 (REPIN1); REPIN1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-567, Full length protein
Sequence
MLERRCRGPLAMGLAQPRLLSGPSQESPQTLGKESRGLRQQGTSVAQSGAQAPGRAHRCAHCRRHFPGWVALWLHTRRCQARLPLPCPECGRRFRHAPFLALHRQVHAAATPDLGFACHLCGQSFRGWVALVLHLRAHSAAKRPIACPKCERRFWRRKQLRAHLRRCHPPAPEARPFICGNCGRSFAQWDQLVAHKRVHVAEALEEAAAKALGPRPRGRPAVTAPRPGGDAVDRPFQCACCGKRFRHKPNLIAHRRVHTGERPHQCPECGKRFTNKPYLTSHRRIHTGEKPYPCKECGRRFRHKPNLLSHSKIHKRSEGSAQAAPGPGSPQLPAGPQESAAEPTPAVPLKPAQEPPPGAPPEHPQDPIEAPPSLYSCDDCGRSFRLERFLRAHQRQHTGERPFTCAECGKNFGKKTHLVAHSRVHSGERPFACEECGRRFSQGSHLAAHRRDHAPDRPFVCPDCGKAFRHKPYLAAHRRIHTGEKPYVCPDCGKAFSQKSNLVSHRRIHTGERPYACPDCDRSFSQKSNLITHRKSHIRDGAFCCAICGQTFDDEERLLAHQKKHDV
Sequence Length
567
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
69,920 Da
NCBI Official Full Name
replication initiator 1 isoform 3
NCBI Official Synonym Full Names
replication initiator 1
NCBI Official Symbol
REPIN1
NCBI Official Synonym Symbols
AP4; RIP60; ZNF464; Zfp464
NCBI Protein Information
replication initiator 1
UniProt Protein Name
Replication initiator 1
Protein Family
UniProt Gene Name
REPIN1
UniProt Synonym Gene Names
RIP60; ZNF464
Uniprot Description
Sequence-specific double-stranded DNA-binding protein required for initiation of chromosomal DNA replication. Binds on 5'-ATT-3' reiterated sequences downstream of the origin of bidirectional replication (OBR) and a second, homologous ATT sequence of opposite orientation situated within the OBR zone. Facilitates DNA bending.
Research Articles on REPIN1
Similar Products
Product Notes
The REPIN1 repin1 (Catalog #AAA1408427) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-567, Full length protein. The amino acid sequence is listed below: MLERRCRGPL AMGLAQPRLL SGPSQESPQT LGKESRGLRQ QGTSVAQSGA QAPGRAHRCA HCRRHFPGWV ALWLHTRRCQ ARLPLPCPEC GRRFRHAPFL ALHRQVHAAA TPDLGFACHL CGQSFRGWVA LVLHLRAHSA AKRPIACPKC ERRFWRRKQL RAHLRRCHPP APEARPFICG NCGRSFAQWD QLVAHKRVHV AEALEEAAAK ALGPRPRGRP AVTAPRPGGD AVDRPFQCAC CGKRFRHKPN LIAHRRVHTG ERPHQCPECG KRFTNKPYLT SHRRIHTGEK PYPCKECGRR FRHKPNLLSH SKIHKRSEGS AQAAPGPGSP QLPAGPQESA AEPTPAVPLK PAQEPPPGAP PEHPQDPIEA PPSLYSCDDC GRSFRLERFL RAHQRQHTGE RPFTCAECGK NFGKKTHLVA HSRVHSGERP FACEECGRRF SQGSHLAAHR RDHAPDRPFV CPDCGKAFRH KPYLAAHRRI HTGEKPYVCP DCGKAFSQKS NLVSHRRIHT GERPYACPDC DRSFSQKSNL ITHRKSHIRD GAFCCAICGQ TFDDEERLLA HQKKHDV. It is sometimes possible for the material contained within the vial of "Replication initiator 1 (REPIN1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
