Replicase polyprotein 1ab (rep) Recombinant Protein | rep recombinant protein
Recombinant Bat coronavirus 512/2005 Replicase polyprotein 1ab (rep), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Replicase polyprotein 1ab (rep); Recombinant Bat coronavirus 512/2005 Replicase polyprotein 1ab (rep); partial; rep recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
6493-6793
Sequence
SAEWKCGYSMPSIYKIQRMCLEPCNLYNYGSGLKLPDGIMFNVVKYTQLCQYLNSTTMCVPHHMRVLHLGAGSDKGVAPGTAVLRRWLPLDAVIVDNDVNDYVSDADFSYTGDCASMYLTDKFDLVISDMYDGRTKSCDGDNVSKEGFFPYINGVITEKLALGGTVAIKITEFSWNKKLYELIQKFEYWTLFCTSVNTSSSEAFLIGVHFLGDFSTNAIIDGNIMHANYIFWRNSTIMTMSYNSVLDLSKFSCKHKATVVVNLKDSSVTDLVLGLLKNGKLLIRNNGVVCGFSNHLVNSTK
Sequence Length
6793
Species
Bat coronavirus 512/2005 (BtCoV) (BtCoV/512/2005)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
456,581 Da
NCBI Official Full Name
ORF1
NCBI Official Symbol
Sc-BatCoV-512_gp1
NCBI Protein Information
ORF1
UniProt Protein Name
Replicase polyprotein 1ab
Protein Family
UniProt Gene Name
rep
UniProt Synonym Gene Names
pp1ab; nsp1; nsp2; nsp3; nsp4; 3CL-PRO; 3CLp; nsp6; nsp7; nsp8; nsp9; nsp10; GFL; Pol; RdRp; Hel; ExoN
Uniprot Description
The replicase polyprotein of coronaviruses is a multifunctional protein: it contains the activities necessary for the transcription of negative stranded RNA, leader RNA, subgenomic mRNAs and progeny virion RNA as well as proteinases responsible for the cleavage of the polyprotein into functional products.The papain-like proteinase 1 (PLP1) and papain-like proteinase 2 (PLP2) are responsible for the cleavages located at the N-terminus of the replicase polyprotein. In addition, PLP2 possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains from cellular substrates. PLP2 also antagonizes innate immune induction of type I interferon by blocking the nuclear translocation of host IRF-3 ().
Similar Products
Product Notes
The rep rep (Catalog #AAA1028327) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 6493-6793. The amino acid sequence is listed below: SAEWKCGYSM PSIYKIQRMC LEPCNLYNYG SGLKLPDGIM FNVVKYTQLC QYLNSTTMCV PHHMRVLHLG AGSDKGVAPG TAVLRRWLPL DAVIVDNDVN DYVSDADFSY TGDCASMYLT DKFDLVISDM YDGRTKSCDG DNVSKEGFFP YINGVITEKL ALGGTVAIKI TEFSWNKKLY ELIQKFEYWT LFCTSVNTSS SEAFLIGVHF LGDFSTNAII DGNIMHANYI FWRNSTIMTM SYNSVLDLSK FSCKHKATVV VNLKDSSVTD LVLGLLKNGK LLIRNNGVVC GFSNHLVNST K. It is sometimes possible for the material contained within the vial of "Replicase polyprotein 1ab (rep), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
