Insulin-Like Growth Factor I Active Protein | IGF1 active protein
Insulin-Like Growth Factor I, Recombinant, Human (IGF1, IGF I)
Gene Names
IGF1; IGFI; IGF-I; IGF1A
Purity
Highly Purified~98% by SDS-PAGE and HPLC analyses. Endotoxin:
Synonyms
Insulin-Like Growth Factor I; Recombinant; Human (IGF1; IGF I); IGF1 active protein
Host
Recombinant, Human (E Coli)
Purity/Purification
Highly Purified
~98% by SDS-PAGE and HPLC analyses. Endotoxin:
~98% by SDS-PAGE and HPLC analyses. Endotoxin:
Form/Format
Supplied as a lyophilized powder with no additives. Reconsitute in sterile ddH2O to a concentration of 0.1-1mg/ml. Also available as a liquid. See I7661-11C.
Sequence
GPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMY CAPLKPAKSA
Biological Activity
1-7ng/ml. Measured in cell proliferation assay with NIH3T3 cells
Preparation and Storage
-20 degree C
Related Product Information for IGF1 active protein
Insulin Like Growth Factor-I (IGF-I) is a polypeptide growth factor which stimulates the proliferation of a wide range of cell types including muscle, bone, and cartilage tissue. Recombinant Human IGF-I is a single, nonglycosylated, 7.6kD protein containing 70 amino acid residues. Insulin-like growth factor 1 (IGF-I) is involved in regulation of neuronal growth and development in central and peripheral nervous system. It is known to protect neurons against cell death induced by amyloidogenic derivatives, glucose or serum
Product Categories/Family for IGF1 active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
7.6kD
NCBI Official Full Name
insulin-like growth factor I
NCBI Official Synonym Full Names
insulin-like growth factor 1 (somatomedin C)
NCBI Official Symbol
IGF1
NCBI Official Synonym Symbols
IGFI; IGF-I; IGF1A
NCBI Protein Information
insulin-like growth factor 1; MGF; IGF-IA; IGF-IB; somatomedin-C; OTTHUMP00000195080; OTTHUMP00000195081; OTTHUMP00000195082; OTTHUMP00000195083; OTTHUMP00000195084; mechano growth factor; insulin-like growth factor I; insulin-like growth factor IA; insulin-like growth factor IB
UniProt Protein Name
Insulin-like growth factor 1 (Somatomedin C), isoform CRA_c
Protein Family
UniProt Gene Name
IGF1
UniProt Entry Name
Q14620_HUMAN
NCBI Description
The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and secreted. Defects in this gene are a cause of insulin-like growth factor I deficiency. Several transcript variants encoding different isoforms have been found for this gene.
Uniprot Description
Subcellular location: Secreted
By similarity RuleBase RU000406.
Sequence similarities: Belongs to the insulin family. RuleBase RU000406
Research Articles on IGF1
Similar Products
Product Notes
The IGF1 igf1 (Catalog #AAA650672) is an Active Protein produced from Recombinant, Human (E Coli) and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: GPRTLCGAEL VDALQFVCGD RGFYFNKPTG YGSSSRRAPQ TGIVDECCFR SCDLRRLEMY CAPLKPAKSA. It is sometimes possible for the material contained within the vial of "Insulin-Like Growth Factor I, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
