Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Exodeoxyribonuclease V beta chain (recB) Recombinant Protein | recB recombinant protein

Recombinant Escherichia coli Exodeoxyribonuclease V beta chain (recB) , partial

Gene Names
recB; ECK2816; ior; JW2788; rorA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Exodeoxyribonuclease V beta chain (recB); Recombinant Escherichia coli Exodeoxyribonuclease V beta chain (recB); partial; recB recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
928-1180, Fragment at the C-terminal, provide the region that has Nuclease activity and interacts with RecD and RecA
Sequence
AAGVASVVEEPTLTPHQFPRGASPGTFLHSLFEDLDFTQPVDPNWVREKLELGGFESQWEPVLTEWITAVLQAPLNETGVSLSQLSARNKQVEMEFYLPISEPLIASQLDTLIRQFDPLSAGCPPLEFMQVRGMLKGFIDLVFRHEGRYYLLDYKSNWLGEDSSAYTQQAMAAAMQAHRYDLQYQLYTLALHRYLRHRIADYDYEHHFGGVIYLFLRGVDKEHPQQGIYTTRPNAGLIALMDEMFAGMTLEEA
Sequence Length
1180
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
133,959 Da
NCBI Official Full Name
exonuclease V (RecBCD complex), beta subunit
NCBI Official Symbol
recB
NCBI Official Synonym Symbols
ECK2816; ior; JW2788; rorA
NCBI Protein Information
exonuclease V (RecBCD complex), beta subunit
UniProt Protein Name
RecBCD enzyme subunit RecB
Protein Family
UniProt Gene Name
recB
UniProt Synonym Gene Names
ExoV subunit RecB

NCBI Description

RecBCD is a bipolar helicase. [More information is available at EcoGene: EG10824]. RecB, RecC, and RecD make up a helicase/nuclease complex that is essential for both homologous recombination during the course of transduction and conjugation as well as in repair of double-strand breaks in Escherichia coli . [More information is available at EcoCyc: EG10824].

Uniprot Description

A helicase/nuclease that prepares dsDNA breaks (DSB) for recombinational DNA repair. Binds to DSBs and unwinds DNA via a rapid (>1 kb/second) and highly processive (>30 kb) ATP-dependent bidirectional helicase. Unwinds dsDNA until it encounters a Chi (crossover hotspot instigator, 5'-GCTGGTGG-3') sequence from the 3' direction. Cuts ssDNA a few nucleotides 3' to Chi site, by nicking one strand or switching the strand degraded (depending on the reaction conditions). The properties and activities of the enzyme are changed at Chi. The Chi-altered holoenzyme produces a long 3'-ssDNA overhang which facilitates RecA-binding to the ssDNA for homologous DNA recombination and repair. Holoenzyme degrades any linearized DNA that is unable to undergo homologous recombination (PubMed:4562392, PubMed:4552016, PubMed:123277). In the holoenzyme this subunit contributes ATPase, 3'-5' helicase, exonuclease activity and loads RecA onto ssDNA. The RecBC complex requires the RecD subunit for nuclease activity, but can translocate along ssDNA in both directions.

Research Articles on recB

Similar Products

Product Notes

The recB recb (Catalog #AAA1116551) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 928-1180, Fragment at the C-terminal, provide the region that has Nuclease activity and interacts with RecD and RecA. The amino acid sequence is listed below: AAGVASVVEE PTLTPHQFPR GASPGTFLHS LFEDLDFTQP VDPNWVREKL ELGGFESQWE PVLTEWITAV LQAPLNETGV SLSQLSARNK QVEMEFYLPI SEPLIASQLD TLIRQFDPLS AGCPPLEFMQ VRGMLKGFID LVFRHEGRYY LLDYKSNWLG EDSSAYTQQA MAAAMQAHRY DLQYQLYTLA LHRYLRHRIA DYDYEHHFGG VIYLFLRGVD KEHPQQGIYT TRPNAGLIAL MDEMFAGMTL EEA . It is sometimes possible for the material contained within the vial of "Exodeoxyribonuclease V beta chain (recB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.