Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Cysteine proteinase RD21a (RD21A) Recombinant Protein | RD21A recombinant protein

Recombinant Arabidopsis thaliana Cysteine proteinase RD21a (RD21A)

Gene Names
RD21A; F2G19.31; F2G19_31; RD21; responsive to dehydration 21; responsive to dehydration 21A; RESPONSIVE TO DEHYDRATION 21A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cysteine proteinase RD21a (RD21A); Recombinant Arabidopsis thaliana Cysteine proteinase RD21a (RD21A); RD21A recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
137-356, Full length protein
Sequence
LPESIDWRKKGAVAEVKDQGGCGSCWAFSTIGAVEGINQIVTGDLITLSEQELVDCDTSYNEGCNGGLMDYAFEFIIKNGGIDTDKDYPYKGVDGTCDQIRKNAKVVTIDSYEDVPTYSEESLKKAVAHQPISIAIEAGGRAFQLYDSGIFDGSCGTQLDHGVVAVGYGTENGKDYWIVRNSWGKSWGESGYLRMARNIASSSGKCGIAIEPSYPIKNGE
Sequence Length
220
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,966 Da
NCBI Official Full Name
Granulin repeat cysteine protease family protein
NCBI Official Symbol
RD21A
NCBI Official Synonym Symbols
F2G19.31; F2G19_31; RD21; responsive to dehydration 21; responsive to dehydration 21A; RESPONSIVE TO DEHYDRATION 21A
NCBI Protein Information
Granulin repeat cysteine protease family protein
UniProt Protein Name
Cysteine proteinase RD21A
Protein Family
UniProt Gene Name
RD21A
UniProt Synonym Gene Names
RD21

NCBI Description

cysteine proteinase precursor-like protein/ dehydration stress-responsive gene (RD21). Has been shown to have peptide ligase activity and protease activity in vitro. RD21 is involved in immunity to the necrotrophic fungal pathogen Botrytis cinerea.

Uniprot Description

Cysteine protease that plays a role in immunity, senescence, and biotic and abiotic stresses (Probable). Involved in immunity against the necrotrophic fungal pathogen Botrytis cinerea (PubMed:22238602). Involved in elicitor-stimulated programmed cell death (PCD). During infection by the necrotrophic fungal pathogen Botrytis cinerea, functions as PCD-promoting protease that is released from the ER body or vacuole to the cytoplasm (PubMed:23398119). Accumulates in endoplasmic reticulum-derived bodies in epidermal cells and may participate in cell death in stressed or injured cells (PubMed:11577182). Involved in water stress-induced cell death through its protease activity that is released to the cytoplasm after vacuolar collapse (PubMed:26884487). Possesses protease activity in vitro and is involved in cell death in the transmitting tract and septum epidermis during flower development (PubMed:26160583). Possesses peptide ligase activity. Can ligate peptides to unmodified N-termini of acceptor proteins. Probably ligates through a thioester intermediate (PubMed:18660805).

Research Articles on RD21A

Similar Products

Product Notes

The RD21A rd21a (Catalog #AAA1062704) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 137-356, Full length protein. The amino acid sequence is listed below: LPESIDWRKK GAVAEVKDQG GCGSCWAFST IGAVEGINQI VTGDLITLSE QELVDCDTSY NEGCNGGLMD YAFEFIIKNG GIDTDKDYPY KGVDGTCDQI RKNAKVVTID SYEDVPTYSE ESLKKAVAHQ PISIAIEAGG RAFQLYDSGI FDGSCGTQLD HGVVAVGYGT ENGKDYWIVR NSWGKSWGES GYLRMARNIA SSSGKCGIAI EPSYPIKNGE. It is sometimes possible for the material contained within the vial of "Cysteine proteinase RD21a (RD21A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.