Anamorsin homolog (RCOM_1680640) Recombinant Protein | RCOM_1680640 recombinant protein
Recombinant Ricinus communis Anamorsin homolog (RCOM_1680640)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Anamorsin homolog (RCOM_1680640); Recombinant Ricinus communis Anamorsin homolog (RCOM_1680640); RCOM_1680640 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-274, Full length protein
Sequence
MDRTRKQCSVLAFTDDAVLPVSTIVNAVRELGNEGAEQCDPQVVTQASSLSKLPVDSSSMDIVISICRSLQFQGDFLFEEISRVLKPGGTVLIYKTLQSVAEGTSEAVLALERKLLLAGFLEAQGLQLNSLELSGLDHSFGMKAKKPSWKIGSSFALKKSTKGSVKVNLDDDLIDEDSLLTEEDMKKPPIAPGGDCEVGSTRKACKNCTCGRAEAEEKVKLGPTMEQLNNPQSACGSCGLGDAFRCSTCPYKGLPPFKLGEKVSLSGNFLAADI
Sequence Length
274
Species
Ricinus communis (Castor bean)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,287 Da
NCBI Official Full Name
anamorsin homolog isoform X2
NCBI Official Symbol
LOC8272152
NCBI Protein Information
anamorsin homolog
UniProt Protein Name
Anamorsin homolog
UniProt Gene Name
RCOM_1680640
Uniprot Description
Component of the cytosolic iron-sulfur (Fe-S) protein assembly (CIA) machinery. Required for the maturation of extramitochondrial Fe-S proteins. Part of an electron transfer chain functioning in an early step of cytosolic Fe-S biogenesis, facilitating the de novo assembly of a [4Fe-4S] cluster on the cytosolic Fe-S scaffold complex. Electrons are transferred from NADPH via a FAD- and FMN-containing diflavin oxidoreductase. Together with the diflavin oxidoreductase, also required for the assembly of the diferric tyrosyl radical cofactor of ribonucleotide reductase (RNR), probably by providing electrons for reduction during radical cofactor maturation in the catalytic small subunit.
Similar Products
Product Notes
The RCOM_1680640 rcom_1680640 (Catalog #AAA1203122) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-274, Full length protein. The amino acid sequence is listed below: MDRTRKQCSV LAFTDDAVLP VSTIVNAVRE LGNEGAEQCD PQVVTQASSL SKLPVDSSSM DIVISICRSL QFQGDFLFEE ISRVLKPGGT VLIYKTLQSV AEGTSEAVLA LERKLLLAGF LEAQGLQLNS LELSGLDHSF GMKAKKPSWK IGSSFALKKS TKGSVKVNLD DDLIDEDSLL TEEDMKKPPI APGGDCEVGS TRKACKNCTC GRAEAEEKVK LGPTMEQLNN PQSACGSCGL GDAFRCSTCP YKGLPPFKLG EKVSLSGNFL AADI. It is sometimes possible for the material contained within the vial of "Anamorsin homolog (RCOM_1680640), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
