Altered inheritance of mitochondria protein 31, mitochondrial (aim31) Recombinant Protein | SJAG_02975 recombinant protein
Recombinant Schizosaccharomyces japonicus Altered inheritance of mitochondria protein 31, mitochondrial (aim31)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Altered inheritance of mitochondria protein 31; mitochondrial (aim31); Recombinant Schizosaccharomyces japonicus Altered inheritance of mitochondria protein 31; Recombinant Altered inheritance of mitochondria protein 31; mitochondrial; SJAG_02975 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-106
Sequence
MAKTSPVVPPIKLSEPTESGNDTTETSGRLKHLFRDQPLIPIGCAATVGAFLFATRAIRRGDSMRANRFFRYRVLAQAATVLAIVGGVFMERKMKQEKRMEQITPK
Sequence Length
106
Species
Schizosaccharomyces japonicus (strain yFS275 / FY16936) (Fission yeast)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11,808 Da
NCBI Official Full Name
hypoxia induced family protein
NCBI Official Symbol
SJAG_02975
NCBI Protein Information
hypoxia induced family protein
UniProt Protein Name
Respiratory supercomplex factor 1, mitochondrial
UniProt Gene Name
rcf1
UniProt Synonym Gene Names
aim31
UniProt Entry Name
RCF1_SCHJY
Uniprot Description
Function: Cytochrome c oxidase subunit which plays a role in assembly of respiratory supercomplexes
By similarity.
Subunit structure: Associates with the respiratory chain complex III/complex IV supercomplex
By similarity.
Subcellular location: Mitochondrion membrane; Multi-pass membrane protein
By similarity.
Sequence similarities: Belongs to the RCF1 family.Contains 1 HIG1 domain.
Similar Products
Product Notes
The SJAG_02975 rcf1 (Catalog #AAA1178635) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-106. The amino acid sequence is listed below: MAKTSPVVPP IKLSEPTESG NDTTETSGRL KHLFRDQPLI PIGCAATVGA FLFATRAIRR GDSMRANRFF RYRVLAQAAT VLAIVGGVFM ERKMKQEKRM EQITPK. It is sometimes possible for the material contained within the vial of "Altered inheritance of mitochondria protein 31, mitochondrial (aim31), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
