CAAX prenyl protease 2 (Rce1) Recombinant Protein | Rce1 recombinant protein
Recombinant Rat CAAX prenyl protease 2 (Rce1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
CAAX prenyl protease 2 (Rce1); Recombinant Rat CAAX prenyl protease 2 (Rce1); Recombinant CAAX prenyl protease 2 (Rce1); CAAX prenyl protease 2 EC= 3.4.22.-; Farnesylated proteins-converting enzyme 2; FACE-2 Prenyl protein-specific endoprotease 2 RCE1 homolog; Rce1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-308
Sequence
MAALGGDGLRLLSVSRPERQPESAALSSPGPGLCCWVSVFSCFSLACSYVGSLYVWKSELPRDHPAVIKRRFTSVLVVSSLSPLCVLLWRELTGIQPGTSLLTLMGFRLEGIFPAALLPLLLTMILFLGPLMQLCMDCPCDLTDGLKVVLAPRSWARRLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCTGLGPAVFTCPLFFGVAHFHHIIEQLRFRQSSVGSIFLSAGHLIGPVLCHSFCNYMGFPAVCAALEHPQKWPLLAGYALGVGLFLLLLQPLTDPKLYGSLPLCMLLERTGASETLLCS
Sequence Length
308
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,646 Da
NCBI Official Full Name
CAAX prenyl protease 2
NCBI Official Synonym Full Names
RCE1 homolog, prenyl protein protease (S. cerevisiae)
NCBI Official Symbol
Rce1
NCBI Protein Information
CAAX prenyl protease 2; FACE-2; RCE1 homolog, prenyl protein peptidase; prenyl protein-specific endoprotease 2; farnesylated proteins-converting enzyme 2
UniProt Protein Name
CAAX prenyl protease 2
UniProt Gene Name
Rce1
UniProt Synonym Gene Names
FACE-2
UniProt Entry Name
FACE2_RAT
Uniprot Description
Function: Proteolytically removes the C-terminal three residues of farnesylated and geranylated proteins. Seems to be able to process K-Ras, N-Ras, H-Ras, RAP1B and G-gamma-1
By similarity.
Subcellular location: Endoplasmic reticulum membrane; Multi-pass membrane protein
By similarity.
Sequence similarities: Belongs to the peptidase U48 family.
Similar Products
Product Notes
The Rce1 rce1 (Catalog #AAA1212765) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-308. The amino acid sequence is listed below: MAALGGDGLR LLSVSRPERQ PESAALSSPG PGLCCWVSVF SCFSLACSYV GSLYVWKSEL PRDHPAVIKR RFTSVLVVSS LSPLCVLLWR ELTGIQPGTS LLTLMGFRLE GIFPAALLPL LLTMILFLGP LMQLCMDCPC DLTDGLKVVL APRSWARRLT DMRWLRNQVI APLTEELVFR ACMLPMLAPC TGLGPAVFTC PLFFGVAHFH HIIEQLRFRQ SSVGSIFLSA GHLIGPVLCH SFCNYMGFPA VCAALEHPQK WPLLAGYALG VGLFLLLLQP LTDPKLYGSL PLCMLLERTG ASETLLCS. It is sometimes possible for the material contained within the vial of "CAAX prenyl protease 2 (Rce1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
