Calcipressin-1 (RCAN1) Recombinant Protein | RCAN1 recombinant protein
Recombinant Bovine Calcipressin-1 (RCAN1)
Gene Names
RCAN1; DSCR1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Calcipressin-1 (RCAN1); Recombinant Bovine Calcipressin-1 (RCAN1); RCAN1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-197, full length protein
Sequence
MHFRNFNYSFSSLIACVANSEIFSESETRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPLSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQENEEEDEMERMKRPKPKIIQTRRPEYTPIHLS
Sequence Length
197
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for RCAN1 recombinant protein
This protein interacts with calcineurin A and inhibits calcineurin-dependent signaling pathways, possibly affecting central nervous system development. This gene is located in the minimal candidate region for the Down syndrome phenotype, and is overexpressed in the brain of Down syndrome fetuses. Chronic overexpression of this gene may lead to neurofibrillary tangles such as those associated with Alzheimer disease. Three transcript variants encoding three different isoforms have been found for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,691 Da
NCBI Official Full Name
calcipressin-1
NCBI Official Synonym Full Names
regulator of calcineurin 1
NCBI Official Symbol
RCAN1
NCBI Official Synonym Symbols
DSCR1
NCBI Protein Information
calcipressin-1
UniProt Protein Name
Calcipressin-1
Protein Family
UniProt Gene Name
RCAN1
UniProt Synonym Gene Names
DSCR1
Uniprot Description
Inhibits calcineurin-dependent transcriptional responses by binding to the catalytic domain of calcineurin A. Could play a role during central nervous system development ().
Similar Products
Product Notes
The RCAN1 rcan1 (Catalog #AAA1470759) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-197, full length protein. The amino acid sequence is listed below: MHFRNFNYSF SSLIACVANS EIFSESETRA KFESLFRTYD KDITFQYFKS FKRVRINFSN PLSAADARLQ LHKTEFLGKE MKLYFAQTLH IGSSHLAPPN PDKQFLISPP ASPPVGWKQV EDATPVINYD LLYAISKLGP GEKYELHAAT DTTPSVVVHV CESDQENEEE DEMERMKRPK PKIIQTRRPE YTPIHLS. It is sometimes possible for the material contained within the vial of "Calcipressin-1 (RCAN1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
