Reverse rubrerythrin-1 (rbr3A) Recombinant Protein | rbr3A recombinant protein
Recombinant Clostridium acetobutylicum Reverse rubrerythrin-1 (rbr3A)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Reverse rubrerythrin-1 (rbr3A); Recombinant Clostridium acetobutylicum Reverse rubrerythrin-1 (rbr3A); rbr3A recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-181, Full length protein
Sequence
MKKFKCVVCGYIYTGEDAPEKCPVCGAGKDKFVEVKDEGEGWADEHKIGVAKGVDKEVLEGLRANFTGECTEVGMYLAMARQADREGYPEVAEAYKRIAFEEAEHASKFAELLGEVVVADTKTNLQMRVDAEKGACEGKKELATLAKKLNYDAIHDTVHEMCKDEARHGSAFRGLLNRYFK
Sequence Length
181
Species
Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,093 Da
NCBI Official Full Name
rubrerythrin
NCBI Official Symbol
CA_C3598
NCBI Protein Information
rubrerythrin
UniProt Protein Name
Reverse rubrerythrin-1
Protein Family
UniProt Gene Name
rbr3A
UniProt Synonym Gene Names
hsp21; rpr1; revRbr 1; NPXase; Npx; Rpr 1
Uniprot Description
Functions as the terminal component of an NADH peroxidase (NADH:H2O2 oxidoreductase) when using NADH:rubredoxin oxidoreductase (NROR) and rubredoxin (Rd) as electron transport intermediaries from NADH to revRbr 1. Plays an important role in the oxidative stress defense system in C.acetobutylicum, an obligate anaerobic bacterium. Also exhibits NADH oxidase (NADH:O2 oxidoreductase) activity in vitro, which is 100-fold lesser than that of FprA1/2 using the same electron transfer components. Therefore, its predominant function is most likely as a scavenger of its preferred substrate, H2O2.
Similar Products
Product Notes
The rbr3A rbr3a (Catalog #AAA1439194) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-181, Full length protein. The amino acid sequence is listed below: MKKFKCVVCG YIYTGEDAPE KCPVCGAGKD KFVEVKDEGE GWADEHKIGV AKGVDKEVLE GLRANFTGEC TEVGMYLAMA RQADREGYPE VAEAYKRIAF EEAEHASKFA ELLGEVVVAD TKTNLQMRVD AEKGACEGKK ELATLAKKLN YDAIHDTVHE MCKDEARHGS AFRGLLNRYF K. It is sometimes possible for the material contained within the vial of "Reverse rubrerythrin-1 (rbr3A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
