SDS-PAGE
Ribonucleoprotein PTB-binding 2 Recombinant Protein | RAVER2 recombinant protein
Recombinant Human Ribonucleoprotein PTB-binding 2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ribonucleoprotein PTB-binding 2; Recombinant Human Ribonucleoprotein PTB-binding 2; Protein raver-2; RAVER2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-691aa; Full Length
Sequence
AAAAGDGGGEGGAGLGSAAGLGPGPGLRGQGPSAEAHEGAPDPMPAALHPEEVAARLQRMQRELSNRRKILVKNLPQDSNCQEVHDLLKDYDLKYCYVDRNKRTAFVTLLNGEQAQNAIQMFHQYSFRGKDLIVQLQPTDALLCITNVPISFTSEEFEELVRAYGNIERCFLVYSEVTGHSKGYGFVEYMKKDFAAKARLELLGRQLGASALFAQWMDVNLLASELIHSKCLCIDKLPSDYRDSEELLQIFSSVHKPVFCQLAQDEGSYVGGFAVVEYSTAEQAEEVQQAADGMTIKGSKVQVSFCAPGAPGRSTLAALIAAQRVMHSNQKGLLPEPNPVQIMKSLNNPAMLQVLLQPQLCGRAVKPAVLGTPHSLPHLMNPSISPAFLHLNKAHQSSVMGNTSNLFLQNLSHIPLAQQQLMKFENIHTNNKPGLLGEPPAVVLQTALGIGSVLPLKKELGHHHGEAHKTSSLIPTQTTITAGMGMLPFFPNQHIAGQAGPGHSNTQEKQPATVGMAEGNFSGSQPYLQSFPNLAAGSLLVGHHKQQQSQPKGTEISSGAASKNQTSLLGEPPKEIRLSKNPYLNLASVLPSVCLSSPASKTTLHKTGIASSILDAISQGSESQHALEKCIAYSPPFGDYAQVSSLRNEKRGSSYLISAPEGGSVECVDQHSQGTGAYYMETYLKKKRVY
Sequence Length
678
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for RAVER2 recombinant protein
May bind single-stranded nucleic acids. Curated
Product Categories/Family for RAVER2 recombinant protein
References
Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.DNA Res. 7:273-281(2000)
The full-ORF clone resource of the German cDNA consortium.Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.BMC Genomics 8:399-399(2007)
A quantitative atlas of mitotic phosphorylation.Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008)
Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.Anal. Chem. 81:4493-4501(2009)
N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012)
Solution structure of RNA binding domain in BAB13405.RIKEN structural genomics initiative (RSGI)
Submitted (NOV-2004)
to the PDB data bank
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
17 kDa
NCBI Official Full Name
ribonucleoprotein PTB-binding 2
NCBI Official Synonym Full Names
ribonucleoprotein, PTB-binding 2
NCBI Official Symbol
RAVER2
NCBI Protein Information
ribonucleoprotein PTB-binding 2
UniProt Protein Name
Ribonucleoprotein PTB-binding 2
Protein Family
UniProt Gene Name
RAVER2
UniProt Synonym Gene Names
KIAA1579
UniProt Entry Name
RAVR2_HUMAN
Uniprot Description
RAVER2: May bind single stranded nucleic acids (Potential). 2 isoforms of the human protein are produced by alternative splicing.
Protein type: RNA-binding
Chromosomal Location of Human Ortholog: 1p31.3
Cellular Component: cytoplasm; nucleus
Molecular Function: nucleic acid binding; nucleotide binding
Biological Process: nuclear mRNA splicing, via spliceosome
Research Articles on RAVER2
Similar Products
Product Notes
The RAVER2 raver2 (Catalog #AAA1336865) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-691aa; Full Length. The amino acid sequence is listed below: AAAAGDGGGE GGAGLGSAAG LGPGPGLRGQ GPSAEAHEGA PDPMPAALHP EEVAARLQRM QRELSNRRKI LVKNLPQDSN CQEVHDLLKD YDLKYCYVDR NKRTAFVTLL NGEQAQNAIQ MFHQYSFRGK DLIVQLQPTD ALLCITNVPI SFTSEEFEEL VRAYGNIERC FLVYSEVTGH SKGYGFVEYM KKDFAAKARL ELLGRQLGAS ALFAQWMDVN LLASELIHSK CLCIDKLPSD YRDSEELLQI FSSVHKPVFC QLAQDEGSYV GGFAVVEYST AEQAEEVQQA ADGMTIKGSK VQVSFCAPGA PGRSTLAALI AAQRVMHSNQ KGLLPEPNPV QIMKSLNNPA MLQVLLQPQL CGRAVKPAVL GTPHSLPHLM NPSISPAFLH LNKAHQSSVM GNTSNLFLQN LSHIPLAQQQ LMKFENIHTN NKPGLLGEPP AVVLQTALGI GSVLPLKKEL GHHHGEAHKT SSLIPTQTTI TAGMGMLPFF PNQHIAGQAG PGHSNTQEKQ PATVGMAEGN FSGSQPYLQS FPNLAAGSLL VGHHKQQQSQ PKGTEISSGA ASKNQTSLLG EPPKEIRLSK NPYLNLASVL PSVCLSSPAS KTTLHKTGIA SSILDAISQG SESQHALEKC IAYSPPFGDY AQVSSLRNEK RGSSYLISAP EGGSVECVDQ HSQGTGAYYM ETYLKKKRVY. It is sometimes possible for the material contained within the vial of "Ribonucleoprotein PTB-binding 2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
