Ribosome association toxin RatA (ratA) Recombinant Protein | ratA recombinant protein

Recombinant Escherichia coli Ribosome association toxin RatA (ratA)

Cat. Num. AAA1097204

• Gene Names: ratA; ECK2615; JW2600; pasT; yfjG
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Ribosome association toxin RatA (ratA); Recombinant Escherichia coli Ribosome association toxin RatA (ratA); ratA recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-158, full length protein
• Sequence: MILFVGFLLMEIVMPQISRTALVPYSAEQMYQLVNDVQSYPQFLPGCTGSRILESTPGQMTAAVDVSKAGISKTFTTRNQLTSNQSILMNLVDGPFKKLIGGWKFTPLSQEACRIEFHLDFEFTNKLIELAFGRVFKELAANMVQAFTVRAKEVYSAR
• Sequence Length: 158

• Species: Escherichia coli (strain K12)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 16130538
• NCBI GeneID: 945614
• NCBI Accession #: NP_417109.1
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P0AGL5; P52121
• Molecular Weight: 17,727 Da
• NCBI Official Full Name: toxic UPF0083 family protein inhibitor of 70S ribosome formation
• NCBI Official Symbol: ratA
• NCBI Official Synonym Symbols: ECK2615; JW2600; pasT; yfjG
• NCBI Protein Information: toxic UPF0083 family protein inhibitor of 70S ribosome formation
• UniProt Protein Name: Ribosome association toxin RatA
• Protein Family: Ribosome association toxin
• UniProt Gene Name: ratA
• UniProt Synonym Gene Names: pasT; yfjG

NCBI Description

Overexpression inhibits growth (Brown, 2003). [More information is available at EcoGene: EG13193]. Episomal expression causes inhibition of cell growth, compared to wild type . [More information is available at EcoCyc: G7358].

Uniprot Description

Toxic component of a type II toxin-antitoxin (TA) system. Binds to 50S ribosomal subunits, preventing them from associating with 30S subunits to form 70S ribosomes and reducing polysomes. It does not cause ribosomes to dissociate however. The antibiotic paromomycin blocks the anti-association activity of RatA. Overexpression results in inhibition of growth in liquid cultures, and in a decrease in protein translation. The other gene of this operon, ratB, is not the cognate antitoxin in this strain; in CFT073 however it does fulfill this function.