Highly validated and characterized monoclonal/polyclonal
antibodies and recombinant
proteins
The majority of AAA Biotech’s antibodies are highly validated and can be use in multiple
applications such as ELISA, FC,
ICC, IF, IHC, IP, WB, etc. We have antibodies available for rare species, in multiple conjugated
forms or recombinant
antibodies.
As for our high quality proteins, the majority have 90% purity, detected by SDS-PAGE while some are
available in
different tags such as Flag, GST, His, MBP, etc. We also carry high quality native and biologically
active proteins.
AAA Biotech is constantly working to expand our capacity to provide recombinant proteins and
antibodies to most
target proteins.
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '30589'
AND `pd`.`language_id` = 1
LIMIT 1
Query
Database
2.17 ms
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '30589' and pd.language_id = 1
Query
Database
1.80 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '30589'
Database (4 total Queries, 4 of them unique across 2 Connections)
Time
Query String
2.1 ms
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '30589'
AND `pd`.`language_id` = 1
LIMIT 1
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '30589' and pd.language_id = 1
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '30589'
⇄⧉testing_protocols => string (877) "IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human ...
$value['testing_protocols']
IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human liver cancer using AKR1C2 Rabbit pAb.||AAA30589_IHC7.jpg!!IF (Immunofluorescence)||Immunofluorescence analysis of U-2 OS cells using AKR1C2 Polyclonal Antibody.||AAA30589_IF6.jpg!!IF (Immunofluorescence)||Immunofluorescence analysis of L929 cells using AKR1C2 Polyclonal Antibody.||AAA30589_IF5.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded mouse liver using AKR1C2 Rabbit pAb.||AAA30589_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human Colon cancer using AKR1C2 Rabbit pAb.||AAA30589_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat liver using AKR1C2 Rabbit pAb.||AAA30589_IHC2.jpg!!WB (Western Blot)||Western blot analysis of extracts of various cell lines, using AKR1C2 antibody.||AAA30589_WB.jpg
⇄etc_term1 => string (68) "Immunogen||Recombinant fusion protein of human AKR1C2 (NP_995317.1)."
⇄⧉products_description => string (663) "This gene encodes a member of the aldo/keto reductase superfamily, which con...
$value['products_description']
This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols using NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. Three transcript variants encoding two different isoforms have been found for this gene.
⇄⧉ncbi_protein_info => string (255) "aldo-keto reductase family 1 member C2; DD-2; DD/BABP; 3-alpha-HSD3; pseudo-...
$value['ncbi_protein_info']
aldo-keto reductase family 1 member C2; DD-2; DD/BABP; 3-alpha-HSD3; pseudo-chlordecone reductase; type II dihydrodiol dehydrogenase; chlordecone reductase homolog HAKRD; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; dihydrodiol dehydrogenase 2; bile a
⇄⧉testing_protocols => string (877) "IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human ...
$value->a['testing_protocols']
IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human liver cancer using AKR1C2 Rabbit pAb.||AAA30589_IHC7.jpg!!IF (Immunofluorescence)||Immunofluorescence analysis of U-2 OS cells using AKR1C2 Polyclonal Antibody.||AAA30589_IF6.jpg!!IF (Immunofluorescence)||Immunofluorescence analysis of L929 cells using AKR1C2 Polyclonal Antibody.||AAA30589_IF5.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded mouse liver using AKR1C2 Rabbit pAb.||AAA30589_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human Colon cancer using AKR1C2 Rabbit pAb.||AAA30589_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat liver using AKR1C2 Rabbit pAb.||AAA30589_IHC2.jpg!!WB (Western Blot)||Western blot analysis of extracts of various cell lines, using AKR1C2 antibody.||AAA30589_WB.jpg
⇄etc_term1 => string (68) "Immunogen||Recombinant fusion protein of human AKR1C2 (NP_995317.1)."
⇄⧉products_description => string (663) "This gene encodes a member of the aldo/keto reductase superfamily, which con...
$value->a['products_description']
This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols using NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. Three transcript variants encoding two different isoforms have been found for this gene.
⇄⧉ncbi_protein_info => string (255) "aldo-keto reductase family 1 member C2; DD-2; DD/BABP; 3-alpha-HSD3; pseudo-...
$value->a['ncbi_protein_info']
aldo-keto reductase family 1 member C2; DD-2; DD/BABP; 3-alpha-HSD3; pseudo-chlordecone reductase; type II dihydrodiol dehydrogenase; chlordecone reductase homolog HAKRD; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; dihydrodiol dehydrogenase 2; bile a
⇄⧉testing_protocols => string (877) "IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human ...
$value->d['testing_protocols']
IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human liver cancer using AKR1C2 Rabbit pAb.||AAA30589_IHC7.jpg!!IF (Immunofluorescence)||Immunofluorescence analysis of U-2 OS cells using AKR1C2 Polyclonal Antibody.||AAA30589_IF6.jpg!!IF (Immunofluorescence)||Immunofluorescence analysis of L929 cells using AKR1C2 Polyclonal Antibody.||AAA30589_IF5.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded mouse liver using AKR1C2 Rabbit pAb.||AAA30589_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human Colon cancer using AKR1C2 Rabbit pAb.||AAA30589_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat liver using AKR1C2 Rabbit pAb.||AAA30589_IHC2.jpg!!WB (Western Blot)||Western blot analysis of extracts of various cell lines, using AKR1C2 antibody.||AAA30589_WB.jpg
⇄etc_term1 => string (68) "Immunogen||Recombinant fusion protein of human AKR1C2 (NP_995317.1)."
⇄⧉products_description => string (663) "This gene encodes a member of the aldo/keto reductase superfamily, which con...
$value->d['products_description']
This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols using NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. Three transcript variants encoding two different isoforms have been found for this gene.
⇄⧉ncbi_protein_info => string (255) "aldo-keto reductase family 1 member C2; DD-2; DD/BABP; 3-alpha-HSD3; pseudo-...
$value->d['ncbi_protein_info']
aldo-keto reductase family 1 member C2; DD-2; DD/BABP; 3-alpha-HSD3; pseudo-chlordecone reductase; type II dihydrodiol dehydrogenase; chlordecone reductase homolog HAKRD; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; dihydrodiol dehydrogenase 2; bile a
⇄⧉specificity => string (376) "This assay has high sensitivity and excellent specificity for detection of C...
$value[0]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of CD45. No significant cross-reactivity or interference between CD45 and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between CD45 and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[0]['_source']['purity']
⇄form => string (3) "N/A"
$value[0]['_source']['form']
⇄concentration => string (3) "N/A"
$value[0]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
⇄⧉products_description => string (1389) "Principle of the Assay: CD45 ELISA kit applies the competitive enzyme immuno...
$value[0]['_source']['products_description']
Principle of the Assay: CD45 ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-CD45 antibody and an CD45-HRP conjugate. The assay sample and buffer are incubated together with CD45-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the CD45 concentration since CD45 from samples and CD45-HRP conjugate compete for the anti-CD45 antibody binding site. Since the number of sites is limited, as more sites are occupied by CD45 from the sample, fewer sites are left to bind CD45-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The CD45 concentration in each sample is interpolated from this standard curve.<br><br>Intended Uses: This CD45 ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Human CD45. This ELISA kit for research use only, not for therapeutic or diagnostic applications!
⇄⧉search_terms => string (546) "aaa27241 human typical testing data standard curve for reference only aaa272...
$value[0]['_source']['search_terms']
aaa27241 human typical testing data standard curve for reference only aaa27241_sc elisa kit cluster of differentiation 45 cd45 partial protein tyrosine phosphatase receptor type c ptprc lca ly5 b220 l ca t200 cd45r gp180 antigen glycoprotein leukocyte common polypeptide 130,898 da cd_antigen ptprc_human 44242008 aas46946.1 p08575 q16614 q9h0y6 a8k7w6 gene 608971 immunology samples serum plasma cell culture supernatants body fluid and tissue homogenate assay competitive detection range 1.0 25ng ml sensitivity 0.1ng differentiation45 range1.0
Samples||Serum, plasma, cell culture supernates, ascites, tissue homogenates or other biological fluids!!Assay Type||Quantitative Sandwich!!Detection Range||2-700ng/ml!!Sensitivity||1.13ng/ml
⇄⧉etc_term2 => string (403) "Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Thr...
$value[1]['_source']['etc_term2']
Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Three samples of known concentration were tested on one plate to assess intra-assay precision. Intra-Assay: CV<8%!!Inter-assay Precision||Inter-Assay Precision (Precision between assays) Three samples of known concentration were tested in separate assays to assess inter-assay precision. CV(%) = SD/mean x 100. Inter-Assay: CV<10%
⇄products_price => string (6) "0.0000"
$value[1]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[1]['_source']['products_weight']
⇄products_status => boolean true
$value[1]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[1]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "160"
$value[1]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[1]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[1]['_source']['language_id']
⇄products_name => string (33) "cluster of differentiation (CD16)"
⇄⧉products_description => string (896) "Intended Uses: This sandwich kit is for the accurate quantitative detection ...
$value[1]['_source']['products_description']
Intended Uses: This sandwich kit is for the accurate quantitative detection of Human cluster of differentiation 16 (also known as CD16) in serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids.<br><br>Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (ELISA). The plate has been pre-coated with Human CD16 antibody. CD16 present in the sample is added and binds to antibodies coated on the wells. And then biotinylated Human CD16 Antibody is added and binds to CD16 in the sample. Then Streptavidin-HRP is added and binds to the Biotinylated CD16 antibody. After incubation unbound Streptavidin-HRP is washed away during a washing step. Substrate solution is then added and color develops in proportion to the amount of Human CD16. The reaction is terminated by addition of acidic stop solution and absorbance is measured at 450 nm.
⇄products_references => string (3) "N/A"
$value[1]['_source']['products_references']
⇄products_related_diseases => string (3) "N/A"
$value[1]['_source']['products_related_diseases']
⇄products_categories => string (3) "N/A"
$value[1]['_source']['products_categories']
⇄ncbi_full_name => string (3) "N/A"
$value[1]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (3) "N/A"
$value[1]['_source']['ncbi_full_name_syn']
⇄ncbi_symbol => string (3) "N/A"
$value[1]['_source']['ncbi_symbol']
⇄ncbi_symbol_syn => string (3) "N/A"
$value[1]['_source']['ncbi_symbol_syn']
⇄ncbi_protein_info => string (3) "N/A"
$value[1]['_source']['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value[1]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (3) "N/A"
$value[1]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (3) "N/A"
$value[1]['_source']['ncbi_mol_weight']
⇄ncbi_pathways => string (3) "N/A"
$value[1]['_source']['ncbi_pathways']
⇄sp_protein_name => string (3) "N/A"
$value[1]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (3) "N/A"
$value[1]['_source']['sp_protein_name_syn']
⇄sp_gene_name => string (3) "N/A"
$value[1]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (3) "N/A"
$value[1]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (3) "N/A"
$value[1]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[1]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[1]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[1]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[1]['_source']['products_viewed']
⇄⧉search_terms => string (463) "aaa11354 human typical testing data standard curve for reference only aaa113...
$value[1]['_source']['search_terms']
aaa11354 human typical testing data standard curve for reference only aaa11354_sc elisa kit cluster of differentiation cd16 samples serum plasma cell culture supernates ascites tissue homogenates or other biological fluids assay type quantitative sandwich detection range 2 700ng ml sensitivity 1.13ng intra precision within an three known concentration were tested on one plate to assess cv<8 inter between assays in separate cv = sd mean x 100 cv<10 range2 x100
Assay Type||Quantitative Sandwich!!Samples||Serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids!!Detection Range||3-900ng/L!!Sensitivity||1.42ng/L
⇄⧉etc_term2 => string (403) "Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Thr...
$value[2]['_source']['etc_term2']
Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Three samples of known concentration were tested on one plate to assess intra-assay precision. Intra-Assay: CV<8%!!Inter-assay Precision||Inter-Assay Precision (Precision between assays) Three samples of known concentration were tested in separate assays to assess inter-assay precision. CV(%) = SD/mean x 100. Inter-Assay: CV<10%
⇄products_price => string (6) "0.0000"
$value[2]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[2]['_source']['products_weight']
⇄products_status => boolean true
$value[2]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[2]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "160"
$value[2]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[2]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[2]['_source']['language_id']
⇄products_name => string (36) "Cluster of differentiation 36 (CD36)"
⇄⧉products_description => string (896) "Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (EL...
$value[2]['_source']['products_description']
Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (ELISA). The plate has been pre-coated with Human CD36 antibody. CD36 present in the sample is added and binds to antibodies coated on the wells. And then biotinylated Human CD36 Antibody is added and binds to CD36 in the sample. Then Streptavidin-HRP is added and binds to the Biotinylated CD36 antibody. After incubation unbound Streptavidin-HRP is washed away during a washing step. Substrate solution is then added and color develops in proportion to the amount of Human CD36. The reaction is terminated by addition of acidic stop solution and absorbance is measured at 450 nm.<br><br>Intended Uses: This sandwich kit is for the accurate quantitative detection of Human Cluster of differentiation 36 (also known as CD36) in serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids.
⇄products_references => string (3) "N/A"
$value[2]['_source']['products_references']
⇄products_related_diseases => string (3) "N/A"
$value[2]['_source']['products_related_diseases']
⇄products_categories => string (3) "N/A"
$value[2]['_source']['products_categories']
⇄ncbi_full_name => string (3) "N/A"
$value[2]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (3) "N/A"
$value[2]['_source']['ncbi_full_name_syn']
⇄ncbi_symbol => string (3) "N/A"
$value[2]['_source']['ncbi_symbol']
⇄ncbi_symbol_syn => string (3) "N/A"
$value[2]['_source']['ncbi_symbol_syn']
⇄ncbi_protein_info => string (3) "N/A"
$value[2]['_source']['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value[2]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (3) "N/A"
$value[2]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (3) "N/A"
$value[2]['_source']['ncbi_mol_weight']
⇄ncbi_pathways => string (3) "N/A"
$value[2]['_source']['ncbi_pathways']
⇄sp_protein_name => string (3) "N/A"
$value[2]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (3) "N/A"
$value[2]['_source']['sp_protein_name_syn']
⇄sp_gene_name => string (3) "N/A"
$value[2]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (3) "N/A"
$value[2]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (3) "N/A"
$value[2]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[2]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[2]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[2]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[2]['_source']['products_viewed']
⇄⧉search_terms => string (488) "aaa11348 human typical testing data standard curve for reference only aaa113...
$value[2]['_source']['search_terms']
aaa11348 human typical testing data standard curve for reference only aaa11348_sc elisa kit cluster of differentiation 36 cd36 samples serum plasma cell culture supernates ascites tissue homogenates or other biological fluids assay type quantitative sandwich detection range 3 900ng l sensitivity 1.42ng intra precision within an three known concentration were tested on one plate to assess cv< 10 inter between assays in separate cv = sd mean x 100 12 differentiation36 range3 cv<10 x100
⇄⧉specificity => string (187) "This assay has high sensitivity and excellent specificity for detection of H...
$value[3]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of Human SMARCA2. No significant cross-reactivity or interference between Human SMARCA2 and analogues was observed.
⇄purity => string (3) "N/A"
$value[3]['_source']['purity']
⇄form => string (3) "N/A"
$value[3]['_source']['form']
⇄concentration => string (3) "N/A"
$value[3]['_source']['concentration']
⇄storage_stability => string (22) "Store at 2-8 degree C."
$value[3]['_source']['storage_stability']
⇄app_tested => string (3) "N/A"
$value[3]['_source']['app_tested']
⇄app_notes => string (3) "N/A"
$value[3]['_source']['app_notes']
⇄testing_protocols => string (3) "N/A"
$value[3]['_source']['testing_protocols']
⇄⧉etc_term1 => string (152) "Samples||Serum, plasma and other biological fluids!!Assay Type||Quantitative...
$value[3]['_source']['etc_term1']
Samples||Serum, plasma and other biological fluids!!Assay Type||Quantitative Sandwich!!Detection Range||0.156 ng/mL - 10 ng/mL!!Sensitivity||0.052 ng/mL
⇄⧉etc_term2 => string (421) "Intra-assay Precision||Intra-assay Precision (Precision within an assay) Thr...
$value[3]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay) Three samples of known concentration were tested twenty times on one plate to assess intra-assay precision. Intra-Assay: CV<8%!!Inter-assay Precision||Inter-assay Precision (Precision between assays) Three samples of known concentration were tested in forty separate assays to assess inter-assay precision. CV (%) = SD/meanX100. Inter-Assay: CV<12%
⇄products_price => string (6) "0.0000"
$value[3]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[3]['_source']['products_weight']
⇄products_status => boolean true
$value[3]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[3]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "280"
$value[3]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[3]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[3]['_source']['language_id']
⇄products_name => string (46) "Probable global transcription activator SNF2L2"
⇄⧉products_description => string (947) "Intended Uses: For the quantitative detection of Human Probable global trans...
$value[3]['_source']['products_description']
Intended Uses: For the quantitative detection of Human Probable global transcription activator SNF2L2 (SMARCA2) concentration in serum, plasma and other biological fluids.<br><br>Principle of the Assay: This assay employs a two-site sandwich ELISA to quantitate SMARCA2 in Human serum, plasma. An antibody specific for SMARCA2 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any SMARCA2 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for SMARCA2 is added to the wells. After washing, Streptavidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of SMARCA2 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄products_references => string (3) "N/A"
$value[3]['_source']['products_references']
⇄⧉products_related_diseases => string (258) "Nervous System Diseases||14!!Congenital Abnormalities||10!!Nicolaides Barait...
⇄⧉search_terms => string (764) "aaa13246 human this assay has high sensitivity and excellent specificity for...
$value[3]['_source']['search_terms']
aaa13246 human this assay has high sensitivity and excellent specificity for detection of smarca2 no significant cross reactivity or interference between analogues was observed elisa kit probable global transcription activator snf2l2 isoform a swi snf related matrix associated actin dependent regulator chromatin subfamily member 2 brm snf2 swi2 hbrm ncbrs sth1p baf190 snf2la hsnf2a 179,281 da atp helicase brg1 factor 190b baf190b protein brahma homolog alpha 574957243 np_001276325.1 p51531 nm_001289396.1 b1alg3 b1alg4 d3drh4 d3drh5 x72889 mrna samples serum plasma other biological fluids type quantitative sandwich range 0.156 ng ml 10 0.052 intra precision within an three known concentration were tested twenty times on one plate to assess cv member2 ml10
⇄⧉specificity => string (181) "This assay has high sensitivity and excellent specificity for detection of h...
$value[4]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human CD73. No significant cross-reactivity or interference between human CD73 and analogues was observed.
⇄purity => string (3) "N/A"
$value[4]['_source']['purity']
⇄form => string (3) "N/A"
$value[4]['_source']['form']
⇄concentration => string (3) "N/A"
$value[4]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[4]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[4]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄products_price => string (6) "0.0000"
$value[4]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[4]['_source']['products_weight']
⇄products_status => boolean true
$value[4]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[4]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "700"
$value[4]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[4]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[4]['_source']['language_id']
⇄products_name => string (36) "cluster of differentiation 73 (CD73)"
⇄⧉products_description => string (731) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[4]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for CD73 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any CD73 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for CD73 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of CD73 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄products_references => string (3) "N/A"
$value[4]['_source']['products_references']
⇄products_related_diseases => string (3) "N/A"
$value[4]['_source']['products_related_diseases']
⇄products_categories => string (3) "N/A"
$value[4]['_source']['products_categories']
⇄ncbi_full_name => string (3) "N/A"
$value[4]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (3) "N/A"
$value[4]['_source']['ncbi_full_name_syn']
⇄ncbi_symbol => string (3) "N/A"
$value[4]['_source']['ncbi_symbol']
⇄ncbi_symbol_syn => string (3) "N/A"
$value[4]['_source']['ncbi_symbol_syn']
⇄ncbi_protein_info => string (3) "N/A"
$value[4]['_source']['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value[4]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (3) "N/A"
$value[4]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (3) "N/A"
$value[4]['_source']['ncbi_mol_weight']
⇄ncbi_pathways => string (3) "N/A"
$value[4]['_source']['ncbi_pathways']
⇄sp_protein_name => string (3) "N/A"
$value[4]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (3) "N/A"
$value[4]['_source']['sp_protein_name_syn']
⇄sp_gene_name => string (3) "N/A"
$value[4]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (3) "N/A"
$value[4]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (3) "N/A"
$value[4]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[4]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[4]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[4]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[4]['_source']['products_viewed']
⇄⧉search_terms => string (518) "aaa15498 human this assay has high sensitivity and excellent specificity for...
$value[4]['_source']['search_terms']
aaa15498 human this assay has high sensitivity and excellent specificity for detection of cd73 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa15498_td elisa kit cluster differentiation 73 samples serum plasma tissue homogenates type quantitative sandwich range 3.12 ng ml 200 < 0.78 intra precision within an cv <8 three known concentration were tested twenty times on one plate to assess inter assays <10 in differentiation73 ml200
Assay Type||Quantitative Sandwich!!Samples||Serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids!!Detection Range||0.1-30ng/ml!!Sensitivity||0.05ng/ml
⇄⧉etc_term2 => string (403) "Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Thr...
$value[5]['_source']['etc_term2']
Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Three samples of known concentration were tested on one plate to assess intra-assay precision. Intra-Assay: CV<8%!!Inter-assay Precision||Inter-Assay Precision (Precision between assays) Three samples of known concentration were tested in separate assays to assess inter-assay precision. CV(%) = SD/mean x 100. Inter-Assay: CV<10%
⇄products_price => string (6) "0.0000"
$value[5]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[5]['_source']['products_weight']
⇄products_status => boolean true
$value[5]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[5]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "160"
$value[5]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[5]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[5]['_source']['language_id']
⇄products_name => string (31) "cluster Of differentiation, CD4"
⇄⧉products_description => string (888) "Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (EL...
$value[5]['_source']['products_description']
Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (ELISA). The plate has been pre-coated with Human CD4 antibody. CD4 present in the sample is added and binds to antibodies coated on the wells. And then biotinylated Human CD4 Antibody is added and binds to CD4 in the sample. Then Streptavidin-HRP is added and binds to the Biotinylated CD4 antibody. After incubation unbound Streptavidin-HRP is washed away during a washing step. Substrate solution is then added and color develops in proportion to the amount of Human CD4. The reaction is terminated by addition of acidic stop solution and absorbance is measured at 450 nm.<br><br>Intended Uses: This sandwich kit is for the accurate quantitative detection of Human cluster Of differentiation 4 (also known as CD4) in serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids.
⇄products_references => string (3) "N/A"
$value[5]['_source']['products_references']
⇄products_related_diseases => string (3) "N/A"
$value[5]['_source']['products_related_diseases']
⇄products_categories => string (3) "N/A"
$value[5]['_source']['products_categories']
⇄ncbi_full_name => string (3) "N/A"
$value[5]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (3) "N/A"
$value[5]['_source']['ncbi_full_name_syn']
⇄ncbi_symbol => string (3) "N/A"
$value[5]['_source']['ncbi_symbol']
⇄ncbi_symbol_syn => string (3) "N/A"
$value[5]['_source']['ncbi_symbol_syn']
⇄ncbi_protein_info => string (3) "N/A"
$value[5]['_source']['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value[5]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (3) "N/A"
$value[5]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (3) "N/A"
$value[5]['_source']['ncbi_mol_weight']
⇄ncbi_pathways => string (3) "N/A"
$value[5]['_source']['ncbi_pathways']
⇄sp_protein_name => string (3) "N/A"
$value[5]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (3) "N/A"
$value[5]['_source']['sp_protein_name_syn']
⇄sp_gene_name => string (3) "N/A"
$value[5]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (3) "N/A"
$value[5]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (3) "N/A"
$value[5]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[5]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[5]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[5]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[5]['_source']['products_viewed']
⇄⧉search_terms => string (299) "aaa11292 human typical testing data standard curve for reference only aaa112...
$value[5]['_source']['search_terms']
aaa11292 human typical testing data standard curve for reference only aaa11292_sc elisa kit cluster of differentiation cd4 samples serum plasma cell culture supernates lysates tissue homogenates assay type quantitative sandwich detection range 0.1ng ml 30ng sensitivity 0.05ng intra cv<8 inter cv<10
⇄⧉specificity => string (241) "This assay has high sensitivity and excellent specificity for detection of C...
$value[6]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of Cluster Of Differentiation 200 (CD200).<br> No significant cross-reactivity or interference between Cluster Of Differentiation 200 (CD200) and analogues was observed.
⇄purity => string (3) "N/A"
$value[6]['_source']['purity']
⇄form => string (3) "N/A"
$value[6]['_source']['form']
⇄concentration => string (3) "N/A"
$value[6]['_source']['concentration']
⇄⧉storage_stability => string (475) "The stability of kit is determined by the loss rate of activity. The loss ra...
$value[6]['_source']['storage_stability']
The stability of kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition. <br>To minimize extra influence on the performance, operation procedures and lab conditions, especially room temperature, air humidity, incubator temperature should be strictly controlled. It is also strongly suggested that the whole assay is performed by the same operator from the beginning to the end.
⇄⧉etc_term1 => string (146) "Assay Type||Double-antibody Sandwich!!Samples||Serum, Plasma and other biolo...
$value[6]['_source']['etc_term1']
Assay Type||Double-antibody Sandwich!!Samples||Serum, Plasma and other biological fluids!!Detection Range||31.2-2,000pg/mL!!Sensitivity||12.9pg/mL
⇄⧉etc_term2 => string (510) "Application||Enzyme-linked immunosorbent assay for Antigen Detection.!!Intra...
$value[6]['_source']['etc_term2']
Application||Enzyme-linked immunosorbent assay for Antigen Detection.!!Intra-assay Precision (Precision within an assay)||3 samples with low, middle and high level Cluster Of Differentiation 200 (CD200) were tested 20 times on one plate, respectively.!!Inter-assay Precision (Precision between assays)||3 samples with low, middle and high level Cluster Of Differentiation 200 (CD200) were tested on 3 different plates, 8 replicates in each plate.!!CV(%) =||SD/meanX100!!Intra-Assay||CV<10%!!Inter-Assay||CV<12%
⇄products_price => string (6) "0.0000"
$value[6]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[6]['_source']['products_weight']
⇄products_status => boolean true
$value[6]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[6]['_source']['products_tax_class_id']
⇄manufacturers_id => string (4) "2000"
$value[6]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[6]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[6]['_source']['language_id']
⇄products_name => string (38) "Cluster Of Differentiation 200 (CD200)"
⇄⧉products_description => string (1003) "The test principle applied in this kit is Sandwich enzyme immunoassay. The m...
$value[6]['_source']['products_description']
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Cluster Of Differentiation 200 (CD200). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific to Cluster Of Differentiation 200 (CD200). Next, Avidin conjugated to Horseradish Peroxidase (HRP) is added to each microplate well and incubated. After TMB substrate solution is added, only those wells that contain Cluster Of Differentiation 200 (CD200), biotin-conjugated antibody and enzyme-conjugated Avidin will exhibit a change in color. The enzyme-substrate reaction is terminated by the addition of sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450nm ± 10nm. The concentration of Cluster Of Differentiation 200 (CD200) in the samples is then determined by comparing the O.D. of the samples to the standard curve.
⇄⧉search_terms => string (753) "aaa20362 human this assay has high sensitivity and excellent specificity for...
$value[6]['_source']['search_terms']
aaa20362 human this assay has high sensitivity and excellent specificity for detection of cluster differentiation 200 cd200 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa20362_td elisa kit mox1 mox2 mrc ox 2 my033 antigen identified by monoclonal antibody cd adhesion molecule tumor immunity infection immune type double sandwich samples serum plasma other biological fluids range 31.2 2,000pg ml < 12.9pg application enzyme linked immunosorbent intra precision within an 3 with low middle level were tested 20 times on one plate respectively inter assays different plates 8 replicates in each cv = sd meanx100 cv<10 cv<12 differentiation200 ox2 an3 tested20 plates8
⇄⧉specificity => string (183) "This assay has high sensitivity and excellent specificity for detection of h...
$value[7]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human NR4A2. No significant cross-reactivity or interference between human NR4A2 and analogues was observed.
⇄purity => string (3) "N/A"
$value[7]['_source']['purity']
⇄form => string (3) "N/A"
$value[7]['_source']['form']
⇄concentration => string (3) "N/A"
$value[7]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[7]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[7]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄products_price => string (6) "0.0000"
$value[7]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[7]['_source']['products_weight']
⇄products_status => boolean true
$value[7]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[7]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "700"
$value[7]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[7]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[7]['_source']['language_id']
⇄products_name => string (47) "nuclear receptor subfamily 4, group A, member 2"
$value[7]['_source']['products_name']
⇄products_name_oem => string (68) "Human Nuclear receptor subfamily 4 group A member 2, NR4A2 ELISA Kit"
$value[7]['_source']['products_name_oem']
⇄⧉products_name_syn => string (322) "Human Nuclear receptor subfamily 4 group A member 2 (NR4A2) ELISA kit; HZF-3...
$value[7]['_source']['products_name_syn']
Human Nuclear receptor subfamily 4 group A member 2 (NR4A2) ELISA kit; HZF-3; NOT; NURR1; RNR1; TINUR; NGFI-B/nur77 beta-type transcription factor homolog; OTTHUMP00000204707; T-cell nuclear receptor NOT; intermediate-early receptor protein; nur related protein-1; human ho; nuclear receptor subfamily 4; group A; member 2
⇄products_gene_name => string (5) "NR4A2"
$value[7]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[7]['_source']['products_gene_name_syn']
⇄⧉products_description => string (735) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[7]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for NR4A2 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any NR4A2 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for NR4A2 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of NR4A2 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄products_references => string (3) "N/A"
$value[7]['_source']['products_references']
⇄⧉products_related_diseases => string (219) "Nervous System Diseases||106!!Brain Diseases||97!!Movement Disorders||69!!Ne...
$value[7]['_source']['products_related_diseases']
Nervous System Diseases||106!!Brain Diseases||97!!Movement Disorders||69!!Neoplasms||46!!Mental Disorders||39!!Disease Models, Animal||25!!Inflammation||23!!Cardiovascular Diseases||18!!Necrosis||13!!Kidney Diseases||13
⇄products_categories => string (3) "N/A"
$value[7]['_source']['products_categories']
⇄ncbi_full_name => string (45) "nuclear receptor subfamily 4 group A member 2"
$value[7]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (47) "nuclear receptor subfamily 4, group A, member 2"
⇄⧉search_terms => string (953) "aaa18108 human this assay has high sensitivity and excellent specificity for...
$value[7]['_source']['search_terms']
aaa18108 human this assay has high sensitivity and excellent specificity for detection of nr4a2 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa18108_td elisa kit nuclear receptor subfamily 4 group a member 2 hzf 3 not nurr1 rnr1 tinur ngfi b nur77 beta type transcription factor homolog otthump00000204707 t cell intermediate early protein nur related 1 ho orphan immediate response transcriptionally inducible 66,591 da nr4a2_human 5453822 np_006177.1 p43354 nm_006186.3 q16311 q53rz2 601828 samples serum plasma tissue homogenates lysates sandwich range 31.25 pg ml 2000 the minimum detectable dose is typically less than 7.81 ml.the lower limit lld defined as lowest concentration that could be differentiated from zero it determined mean o.d value 20 replicates added by their three deviations intra precision within an cv subfamily4 member2 hzf3 related1 value20
⇄specificity => string (63) "Recognizes human CNOT7. Species Crossreactivity: mouse and rat."
$value[8]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[8]['_source']['purity']
⇄⧉form => string (95) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with All...
$value[8]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
⇄concentration => string (3) "N/A"
$value[8]['_source']['concentration']
⇄⧉storage_stability => string (364) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value[8]['_source']['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (55) "ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)"
$value[8]['_source']['app_tested']
⇄app_notes => string (63) "IF: 40ug/ml<br>Applications are based on unconjugated antibody."
$value[8]['_source']['app_notes']
⇄⧉testing_protocols => string (822) "WB (Western Blot)||CNOT7 monoclonal antibody, Western Blot analysis of CNOT7...
$value[8]['_source']['testing_protocols']
WB (Western Blot)||CNOT7 monoclonal antibody, Western Blot analysis of CNOT7 expression in HeLa.||AAA24469_WB7.jpg!!WB (Western Blot)||CNOT7 monoclonal antibody. Western Blot analysis of CNOT7 expression in PC-12.||AAA24469_WB6.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to CNOT7 on HeLa cell. [antibody concentration 40ug/ml].||AAA24469_IF5.jpg!!WB (Western Blot)||CNOT7 monoclonal antibody. Western Blot analysis of CNOT7 expression in NIH/3T3.||AAA24469_WB4.jpg!!WB (Western Blot)||CNOT7 monoclonal antibody. Western Blot analysis of CNOT7 expression in Raw 264.7.||AAA24469_WB3.jpg!!WB (Western Blot)||CNOT7 monoclonal antibody. Western Blot analysis of CNOT7 expression in Hela NE.||AAA24469_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (57.46kD).||AAA24469_WB.jpg
⇄⧉etc_term1 => string (457) "Immunogen||Full length recombinant corresponding to aa1-286 from human CNOT7...
$value[8]['_source']['etc_term1']
Immunogen||Full length recombinant corresponding to aa1-286 from human CNOT7 (AAH60852) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS!!Conjugate||APC
⇄⧉search_terms => string (1166) "aaa24469 mouse human rat monoclonal igg 2f6 purified by protein a affinity c...
$value[8]['_source']['search_terms']
aaa24469 mouse human rat monoclonal igg 2f6 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with allophycocyanin apc recognizes cnot7 species crossreactivity and elisa eia immunofluorescence if western blot wb 40ug ml applications are based on unconjugated antibody detection against immunogen 57.46kd aaa24469_wb analysis of expression hela ne aaa24469_wb2 raw 264.7 aaa24469_wb3 nih 3t3 aaa24469_wb4 to cell concentration aaa24469_if5 pc 12 aaa24469_wb6 aaa24469_wb7 ccr4 not transcription complex subunit 7 btg1 binding factor 1 associated caf caf1 homo sapiens mrna caf1a hcaf 28,228 da 38174537 bc060852 aah60852 q9uiv1 q7z530 a8mzm5 b3kmp1 b3kn35 d3dsp6 g3v108 antibodies factors full length recombinant corresponding aa1 286 from gst tag mw the alone is 26kd sequence mpaatvdhsqricevwacnldeemkkirqvirkynyvamdtefpgvvarpigefrsnadyqyqllrcnvdllkiiqlgltfmneqgeyppgtstwqfnfkfnltedmyaqdsiellttsgiqfkkheeegietqyfaellmtsgvvlcegvkwlsfhsgydfgylikiltnsnlpeeeldffeilrlffpviydvkylmkscknlkgglqevaeqlelerigpqhqagsdslltgmaffkmremffedhiddakycghlyglgsgssyvqngtgnayeeeankqs conjugate ph7.2 pc12 subunit7 factor1 aa1286
⇄specificity => string (63) "Recognizes human CNOT7. Species Crossreactivity: mouse and rat."
$value[9]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[9]['_source']['purity']
⇄⧉form => string (80) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Bio...
$value[9]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
⇄concentration => string (3) "N/A"
$value[9]['_source']['concentration']
⇄⧉storage_stability => string (439) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[9]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (55) "ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)"
$value[9]['_source']['app_tested']
⇄app_notes => string (63) "IF: 40ug/ml<br>Applications are based on unconjugated antibody."
$value[9]['_source']['app_notes']
⇄⧉testing_protocols => string (822) "WB (Western Blot)||CNOT7 monoclonal antibody, Western Blot analysis of CNOT7...
$value[9]['_source']['testing_protocols']
WB (Western Blot)||CNOT7 monoclonal antibody, Western Blot analysis of CNOT7 expression in HeLa.||AAA24764_WB7.jpg!!WB (Western Blot)||CNOT7 monoclonal antibody. Western Blot analysis of CNOT7 expression in PC-12.||AAA24764_WB6.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to CNOT7 on HeLa cell. [antibody concentration 40ug/ml].||AAA24764_IF5.jpg!!WB (Western Blot)||CNOT7 monoclonal antibody. Western Blot analysis of CNOT7 expression in NIH/3T3.||AAA24764_WB4.jpg!!WB (Western Blot)||CNOT7 monoclonal antibody. Western Blot analysis of CNOT7 expression in Raw 264.7.||AAA24764_WB3.jpg!!WB (Western Blot)||CNOT7 monoclonal antibody. Western Blot analysis of CNOT7 expression in Hela NE.||AAA24764_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (57.46kD).||AAA24764_WB.jpg
⇄⧉etc_term1 => string (460) "Immunogen||Full length recombinant corresponding to aa1-286 from human CNOT7...
$value[9]['_source']['etc_term1']
Immunogen||Full length recombinant corresponding to aa1-286 from human CNOT7 (AAH60852) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS!!Conjugate||Biotin
⇄⧉search_terms => string (1153) "aaa24764 mouse human rat monoclonal igg 2f6 purified by protein a affinity c...
$value[9]['_source']['search_terms']
aaa24764 mouse human rat monoclonal igg 2f6 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with biotin recognizes cnot7 species crossreactivity and elisa eia immunofluorescence if western blot wb 40ug ml applications are based on unconjugated antibody detection against immunogen 57.46kd aaa24764_wb analysis of expression hela ne aaa24764_wb2 raw 264.7 aaa24764_wb3 nih 3t3 aaa24764_wb4 to cell concentration aaa24764_if5 pc 12 aaa24764_wb6 aaa24764_wb7 ccr4 not transcription complex subunit 7 btg1 binding factor 1 associated caf caf1 homo sapiens mrna caf1a hcaf 28,228 da 38174537 bc060852 aah60852 q9uiv1 q7z530 a8mzm5 b3kmp1 b3kn35 d3dsp6 g3v108 antibodies factors full length recombinant corresponding aa1 286 from gst tag mw the alone is 26kd sequence mpaatvdhsqricevwacnldeemkkirqvirkynyvamdtefpgvvarpigefrsnadyqyqllrcnvdllkiiqlgltfmneqgeyppgtstwqfnfkfnltedmyaqdsiellttsgiqfkkheeegietqyfaellmtsgvvlcegvkwlsfhsgydfgylikiltnsnlpeeeldffeilrlffpviydvkylmkscknlkgglqevaeqlelerigpqhqagsdslltgmaffkmremffedhiddakycghlyglgsgssyvqngtgnayeeeankqs conjugate ph7.2 pc12 subunit7 factor1 aa1286
⇄⧉testing_protocols => string (1238) "IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded mouse ...
$value[10]['_source']['testing_protocols']
IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded mouse brain using Smarcd1 antibody at dilution of 1:100 (40x lens).||AAA28224_IHC7.jpg!!IHC (Immunohistchemistry)||Immunohistochemistry of paraffin-embedded human lung cancer using Smarcd1 antibody at dilution of 1:100 (40x lens).||AAA28224_IHC6.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat brain using Smarcd1 antibody at dilution of 1:100 (40x lens).||AAA28224_IHC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human lung cancer using Smarcd1 antibody (40x lens).||AAA28224_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat brain using Smarcd1 antibody (40x lens).||AAA28224_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded mouse brain using Smarcd1 antibody (40x lens).||AAA28224_IHC2.jpg!!WB (Western Blot)||Western blot analysis of extracts of various cell lines, using Smarcd1 antibody at 1:1000 dilution.<br>Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.<br>Lysates/proteins: 25ug per lane.<br>Blocking buffer: 3% nonfat dry milk in TBST.<br>Detection: ECL Basic Kit.<br>Exposure time: 15s.||AAA28224_WB.jpg
⇄etc_term1 => string (46) "Immunogen||Recombinant protein of human BAF60a"
⇄⧉etc_term1 => string (158) "Samples||Serum, Plasma, Cell Culture Supernatants, Body Fluid And Tissue Hom...
$value[11]['_source']['etc_term1']
Samples||Serum, Plasma, Cell Culture Supernatants, Body Fluid And Tissue Homogenate!!Assay Type||Quantitative Competitive or Sandwich!!Sensitivity||1.0 ng/mL.
⇄etc_term2 => string (3) "N/A"
$value[11]['_source']['etc_term2']
⇄products_price => string (6) "0.0000"
$value[11]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[11]['_source']['products_weight']
⇄products_status => boolean true
$value[11]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[11]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "720"
$value[11]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[11]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[11]['_source']['language_id']
⇄products_name => string (44) "soluble Cluster of differentiation 40 ligand"
⇄⧉products_description => string (1331) "Intended Uses: This sCD4 ELISA kit is a 1.5 hour solid-phase ELISA designed ...
$value[11]['_source']['products_description']
Intended Uses: This sCD4 ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Human sCD4. This ELISA kit for research use only!<br><br>Principle of the Assay: sCD4 ELISA kit applies the competitive enzyme immunoassay technique utilizing an anti-sCD4 antibody and an sCD4-HRP conjugate. The assay sample and buffer are incubated together with sCD4-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the sCD4 concentration since sCD4 from samples and sCD4-HRP conjugate compete for the anti-sCD4 antibody binding site. Since the number of sites is limited, as more sites are occupied by sCD4 from the sample, fewer sites are left to bind sCD4-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The sCD4 concentration in each sample is interpolated from this standard curve.
⇄⧉search_terms => string (338) "aaa16939 monkey typical testing data standard curve for reference only aaa16...
$value[11]['_source']['search_terms']
aaa16939 monkey typical testing data standard curve for reference only aaa16939_sc elisa kit soluble cluster of differentiation 40 ligand scd40l immunology samples serum plasma cell culture supernatants body fluid and tissue homogenate assay type quantitative competitive or sandwich sensitivity 1.0 ng ml differentiation40 sensitivity1.0
⇄specificity => string (76) "Specifically recognize sCD14, no obvious cross reaction with other analogues"
$value[12]['_source']['specificity']
⇄purity => string (3) "N/A"
$value[12]['_source']['purity']
⇄form => string (3) "N/A"
$value[12]['_source']['form']
⇄concentration => string (3) "N/A"
$value[12]['_source']['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value[12]['_source']['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
Assay Type||Sandwich!!Samples||Serum, plasma, cell culture supernatant and other biological samples!!Detection Range||0.156-10ng/ml!!Sensitivity||0.094ng/ml
⇄⧉etc_term2 => string (270) "Intra-assay Precision||Intra-assay Precision: samples with low, medium and h...
$value[12]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision: samples with low, medium and high concentration are tested 20 times on same plate.!!Inter-assay Precision||Inter-assay Precision: samples with low, medium and high concentration are tested 20 times on three different plates.
⇄products_price => string (6) "0.0000"
$value[12]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[12]['_source']['products_weight']
⇄products_status => boolean true
$value[12]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[12]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "760"
$value[12]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[12]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[12]['_source']['language_id']
⇄products_name => string (36) "Soluble Cluster of Differentiation14"
⇄⧉products_description => string (1436) "Background: Soluble cluster of differentiation 14 (sCD14) is a marker of imm...
$value[12]['_source']['products_description']
Background: Soluble cluster of differentiation 14 (sCD14) is a marker of immune activation and has primarily been studied in the context of HIV, and elevated sCD14 levels in plasma or serum are predictors of morbidity and mortality in HIV-infected patients. It has also been associated with a variety of infectious and inflammatory conditions, including rheumatoid arthritis, cystic fibrosis pulmonary exacerbations, cardiovascular disease, and hepatitis B or C virus infection.<br><br>Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Anti sCD14 antibody was precoated onto the 96-well plate. The biotin conjugated anti sCD14 antibody was used as the detection antibody. The standards and pilot samples were added to the wells subsequently. After incubation, unbound conjugates were removed by wash buffer. Then, biotinylated detection antibody was added to bind with sCD14 conjugated on coated antibody. After washing off unbound conjugates, HRP-Streptavidin was added. After a third washing, TMB substrates were added to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that turned yellow after adding a stop solution. Read the O.D. absorbance at 450nm in a microplate reader. The concentration of sCD14 in the sample was calculated by drawing a standard curve. The concentration of the target substance is proportional to the OD450 value.
⇄⧉search_terms => string (528) "aaa17534 human this assay has high sensitivity and excellent specificity for...
$value[12]['_source']['search_terms']
aaa17534 human this assay has high sensitivity and excellent specificity for detection of scd14 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa17534_sc elisa kit soluble cluster differentiation14 cd14 antigen molecule monocyte differentiation myeloid cell specific leucine rich glycoprotein samples serum plasma tissue homogenates other biological fluids type quantitative sandwich range 0.156 10ng ml 0.094ng intra precision cv<8 inter cv<10
⇄specificity => string (63) "Recognizes human CNOT7. Species Crossreactivity: mouse and rat."
$value[13]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[13]['_source']['purity']
⇄⧉form => string (99) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alk...
$value[13]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
⇄concentration => string (3) "N/A"
$value[13]['_source']['concentration']
⇄⧉storage_stability => string (304) "Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 mont...
$value[13]['_source']['storage_stability']
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (30) "ELISA (EIA), Western Blot (WB)"
$value[13]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[13]['_source']['app_notes']
⇄⧉testing_protocols => string (822) "WB (Western Blot)||CNOT7 monoclonal antibody, Western Blot analysis of CNOT7...
$value[13]['_source']['testing_protocols']
WB (Western Blot)||CNOT7 monoclonal antibody, Western Blot analysis of CNOT7 expression in HeLa.||AAA24173_WB7.jpg!!WB (Western Blot)||CNOT7 monoclonal antibody. Western Blot analysis of CNOT7 expression in PC-12.||AAA24173_WB6.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to CNOT7 on HeLa cell. [antibody concentration 40ug/ml].||AAA24173_IF5.jpg!!WB (Western Blot)||CNOT7 monoclonal antibody. Western Blot analysis of CNOT7 expression in NIH/3T3.||AAA24173_WB4.jpg!!WB (Western Blot)||CNOT7 monoclonal antibody. Western Blot analysis of CNOT7 expression in Raw 264.7.||AAA24173_WB3.jpg!!WB (Western Blot)||CNOT7 monoclonal antibody. Western Blot analysis of CNOT7 expression in Hela NE.||AAA24173_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (57.46kD).||AAA24173_WB.jpg
⇄⧉etc_term1 => string (456) "Immunogen||Full length recombinant corresponding to aa1-286 from human CNOT7...
$value[13]['_source']['etc_term1']
Immunogen||Full length recombinant corresponding to aa1-286 from human CNOT7 (AAH60852) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS!!Conjugate||AP
⇄⧉search_terms => string (1170) "aaa24173 mouse human rat monoclonal igg 2f6 purified by protein a affinity c...
$value[13]['_source']['search_terms']
aaa24173 mouse human rat monoclonal igg 2f6 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with alkaline phosphatase ap recognizes cnot7 species crossreactivity and elisa eia western blot wb applications are based on unconjugated antibody detection against immunogen 57.46kd aaa24173_wb analysis of expression hela ne aaa24173_wb2 raw 264.7 aaa24173_wb3 nih 3t3 aaa24173_wb4 immunofluorescence if to cell concentration 40ug ml aaa24173_if5 pc 12 aaa24173_wb6 aaa24173_wb7 ccr4 not transcription complex subunit 7 btg1 binding factor 1 associated caf caf1 homo sapiens mrna caf1a hcaf 28,228 da 38174537 bc060852 aah60852 q9uiv1 q7z530 a8mzm5 b3kmp1 b3kn35 d3dsp6 g3v108 antibodies factors full length recombinant corresponding aa1 286 from gst tag mw the alone is 26kd sequence mpaatvdhsqricevwacnldeemkkirqvirkynyvamdtefpgvvarpigefrsnadyqyqllrcnvdllkiiqlgltfmneqgeyppgtstwqfnfkfnltedmyaqdsiellttsgiqfkkheeegietqyfaellmtsgvvlcegvkwlsfhsgydfgylikiltnsnlpeeeldffeilrlffpviydvkylmkscknlkgglqevaeqlelerigpqhqagsdslltgmaffkmremffedhiddakycghlyglgsgssyvqngtgnayeeeankqs conjugate ph7.2 pc12 subunit7 factor1 aa1286
⇄specificity => string (63) "Recognizes human CNOT7. Species Crossreactivity: mouse and rat."
$value[14]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[14]['_source']['purity']
⇄⧉form => string (107) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Flu...
$value[14]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
⇄concentration => string (3) "N/A"
$value[14]['_source']['concentration']
⇄⧉storage_stability => string (488) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[14]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (55) "ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)"
$value[14]['_source']['app_tested']
⇄app_notes => string (63) "IF: 40ug/ml<br>Applications are based on unconjugated antibody."
$value[14]['_source']['app_notes']
⇄⧉testing_protocols => string (822) "WB (Western Blot)||CNOT7 monoclonal antibody, Western Blot analysis of CNOT7...
$value[14]['_source']['testing_protocols']
WB (Western Blot)||CNOT7 monoclonal antibody, Western Blot analysis of CNOT7 expression in HeLa.||AAA25061_WB7.jpg!!WB (Western Blot)||CNOT7 monoclonal antibody. Western Blot analysis of CNOT7 expression in PC-12.||AAA25061_WB6.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to CNOT7 on HeLa cell. [antibody concentration 40ug/ml].||AAA25061_IF5.jpg!!WB (Western Blot)||CNOT7 monoclonal antibody. Western Blot analysis of CNOT7 expression in NIH/3T3.||AAA25061_WB4.jpg!!WB (Western Blot)||CNOT7 monoclonal antibody. Western Blot analysis of CNOT7 expression in Raw 264.7.||AAA25061_WB3.jpg!!WB (Western Blot)||CNOT7 monoclonal antibody. Western Blot analysis of CNOT7 expression in Hela NE.||AAA25061_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (57.46kD).||AAA25061_WB.jpg
⇄⧉etc_term1 => string (458) "Immunogen||Full length recombinant corresponding to aa1-286 from human CNOT7...
$value[14]['_source']['etc_term1']
Immunogen||Full length recombinant corresponding to aa1-286 from human CNOT7 (AAH60852) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS!!Conjugate||FITC
⇄⧉search_terms => string (1178) "aaa25061 mouse human rat monoclonal igg 2f6 purified by protein a affinity c...
$value[14]['_source']['search_terms']
aaa25061 mouse human rat monoclonal igg 2f6 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with fluorescein isothiocyanate fitc recognizes cnot7 species crossreactivity and elisa eia immunofluorescence if western blot wb 40ug ml applications are based on unconjugated antibody detection against immunogen 57.46kd aaa25061_wb analysis of expression hela ne aaa25061_wb2 raw 264.7 aaa25061_wb3 nih 3t3 aaa25061_wb4 to cell concentration aaa25061_if5 pc 12 aaa25061_wb6 aaa25061_wb7 ccr4 not transcription complex subunit 7 btg1 binding factor 1 associated caf caf1 homo sapiens mrna caf1a hcaf 28,228 da 38174537 bc060852 aah60852 q9uiv1 q7z530 a8mzm5 b3kmp1 b3kn35 d3dsp6 g3v108 antibodies factors full length recombinant corresponding aa1 286 from gst tag mw the alone is 26kd sequence mpaatvdhsqricevwacnldeemkkirqvirkynyvamdtefpgvvarpigefrsnadyqyqllrcnvdllkiiqlgltfmneqgeyppgtstwqfnfkfnltedmyaqdsiellttsgiqfkkheeegietqyfaellmtsgvvlcegvkwlsfhsgydfgylikiltnsnlpeeeldffeilrlffpviydvkylmkscknlkgglqevaeqlelerigpqhqagsdslltgmaffkmremffedhiddakycghlyglgsgssyvqngtgnayeeeankqs conjugate ph7.2 pc12 subunit7 factor1 aa1286
⇄⧉products_description => string (1095) "Transcriptional coactivator cooperating with nuclear hormone receptors to po...
$value[15]['_source']['products_description']
Transcriptional coactivator cooperating with nuclear hormone receptors to potentiate transcriptional activation. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a st/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural st/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural st cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth.
⇄⧉products_references => string (2379) "A human homologue of Saccharomyces cerevisiae SNF2/SWI2 and Drosophila brm g...
$value[15]['_source']['products_references']
A human homologue of Saccharomyces cerevisiae SNF2/SWI2 and Drosophila brm genes potentiates transcriptional activation by the glucocorticoid receptor.Muchardt C., Yaniv M.EMBO J. 12:4279-4290(1993)
Two human homologues of Saccharomyces cerevisiae SWI2/SNF2 and Drosophila brahma are transcriptional coactivators cooperating with the estrogen receptor and the retinoic acid receptor.Chiba H., Muramatsu M., Nomoto A., Kato H.Nucleic Acids Res. 22:1815-1820(1994)
DNA sequence and analysis of human chromosome 9.Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.Nature 429:369-374(2004)
⇄⧉products_related_diseases => string (280) "Nervous System Diseases||21!!Congenital Abnormalities||15!!Neurobehavioral M...
⇄⧉search_terms => string (1634) "aaa18437 e coli or yeast baculovirus mammalian cell greater equal to 85 puri...
$value[15]['_source']['search_terms']
aaa18437 e coli or yeast baculovirus mammalian cell greater equal to 85 purity as determined by sds page lyophilized liquid format be during the manufacturing process aaa18437_sds syytvahaiservekqsallingtlkhyqlqglewmvslynnnlngilademglgktiqtialitylmehkrlngpyliivplstlsnwtyefdkwapsvvkisykgtpamrrslvpqlrsgkfnvllttyeyiikdkhilakirwkymivdeghrmknhhckltqvlnthyvaprrilltgtplqnklpelwallnfllptifkscstfeqwfnapfamtgervdlneeetiliirrlhkvlrpfllrrlkkevesqlpekveyvikcdmsalqkilyrhmqakgilltdgsekdkkgkggaktlmntimqlrkicnhpymfqhieesfaehlgysngvingaelyrasgkfelldrilpklratnhrvllfcqmtslmtimedyfafrnflylrldgttksedraallkkfnepgsqyfifllstragglglnlqaadtvvifdsdwnphqdlqaqdrahrigqqnevrvlrlctvnsveekilaaakyklnvdqkviqagmfdqksssherraf
recombinant protein probable global transcription activator snf2l2 human atp dependent helicase smar ca2brg1 associated factor 190b smarca2 isoform a 61.7 kda brg1 baf190b brahma homolog hbrm snf2 alpha swi snf related matrix actin regulator of chromatin subfamily member 2 smca2_human 574957243 np_001276325.1 nm_001289396.1 p51531 b1alg3 b1alg4 d3drh4 d3drh5 181500 neuroscience production note special offer host expressed is manufactured from stock plasmid containing gene colihost stocked in different unit sizes ranging small 10 ug large 1 mg bulk inventory also available has been ordered over and again researchers stood test time both robust important target for research community it part our new program make most popular targets corresponding hosts expanded with quick processing select fastest delivery among all please contact technical support team email [email protected] more details to85 member2 small10 large1
⇄⧉form => string (102) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with hor...
$value[16]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
⇄concentration => string (3) "N/A"
$value[16]['_source']['concentration']
⇄⧉storage_stability => string (537) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[16]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (55) "ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)"
$value[16]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
WB (Western Blot)||SMARCD2 monoclonal antibody (M02), clone 2B2. Western Blot analysis of SMARCD2 expression in Raw 264.7.||AAA26505_WB6.jpg!!WB (Western Blot)||SMARCD2 monoclonal antibody (M02), clone 2B2. Western Blot analysis of SMARCD2 expression in PC-12.||AAA26505_WB5.jpg!!WB (Western Blot)||SMARCD2 monoclonal antibody (M02), clone 2B2. Western Blot analysis of SMARCD2 expression in NIH/3T3.||AAA26505_WB4.jpg!!WB (Western Blot)||SMARCD2 monoclonal antibody (M02), clone 2B2 Western Blot analysis of SMARCD2 expression in Hela S3 NE (Cat # L013V3).||AAA26505_WB3.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to SMARCD2 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26505_IF2.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to SMARCD2 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26505_IF.jpg
Immunogen||SMARCD2 (NP_003068, 398aa-474aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRL!!Conjugate||HRP
⇄⧉search_terms => string (925) "aaa26505 mouse monoclonal igg2a,k 2b2 purified supplied as a liquid in pbs p...
$value[16]['_source']['search_terms']
aaa26505 mouse monoclonal igg2a,k 2b2 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with horseradish peroxidase hrp recognizes smarcd2 elisa eia immunofluorescence if western blot wb applications are based on unconjugated antibody of to hela cell concentration 10 ug ml aaa26505_if aaa26505_if2 m02 clone analysis expression s3 ne cat # l013v3 aaa26505_wb3 nih 3t3 aaa26505_wb4 pc 12 aaa26505_wb5 raw 264.7 aaa26505_wb6 swi snf related matrix associated actin dependent regulator chromatin subfamily d member 2 baf60b cracd2 pro2451 rsc6p sgd2 54kda 60 kda brg 1 brm factor subunit b brg1 60b smrd2_human 148536862 np_003068 q92925 nm_003077 601736 antibodies metalloproteinases immunogen 398aa 474aa partial recombinant protein gst tag mw the alone is 26kd sequence rdfmlsfstdpqdfiqewlrsqrrdlkiitdvignpeeerraafyhqpwaqeavgrhifakvqqrrqeleqvlgirl conjugate ph7.2 concentration10 pc12 member2 54kda60
⇄specificity => string (63) "Recognizes human CNOT7. Species Crossreactivity: mouse and rat."
$value[17]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[17]['_source']['purity']
⇄⧉form => string (102) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with hor...
$value[17]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
⇄concentration => string (3) "N/A"
$value[17]['_source']['concentration']
⇄⧉storage_stability => string (537) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[17]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (30) "ELISA (EIA), Western Blot (WB)"
$value[17]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[17]['_source']['app_notes']
⇄⧉testing_protocols => string (822) "WB (Western Blot)||CNOT7 monoclonal antibody, Western Blot analysis of CNOT7...
$value[17]['_source']['testing_protocols']
WB (Western Blot)||CNOT7 monoclonal antibody, Western Blot analysis of CNOT7 expression in HeLa.||AAA25356_WB7.jpg!!WB (Western Blot)||CNOT7 monoclonal antibody. Western Blot analysis of CNOT7 expression in PC-12.||AAA25356_WB6.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to CNOT7 on HeLa cell. [antibody concentration 40ug/ml].||AAA25356_IF5.jpg!!WB (Western Blot)||CNOT7 monoclonal antibody. Western Blot analysis of CNOT7 expression in NIH/3T3.||AAA25356_WB4.jpg!!WB (Western Blot)||CNOT7 monoclonal antibody. Western Blot analysis of CNOT7 expression in Raw 264.7.||AAA25356_WB3.jpg!!WB (Western Blot)||CNOT7 monoclonal antibody. Western Blot analysis of CNOT7 expression in Hela NE.||AAA25356_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (57.46kD).||AAA25356_WB.jpg
⇄⧉etc_term1 => string (457) "Immunogen||Full length recombinant corresponding to aa1-286 from human CNOT7...
$value[17]['_source']['etc_term1']
Immunogen||Full length recombinant corresponding to aa1-286 from human CNOT7 (AAH60852) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS!!Conjugate||HRP
⇄⧉products_description => string (154) "Ubiquitous transcription factor required for a diverse set of processes. It ...
$value[17]['_source']['products_description']
Ubiquitous transcription factor required for a diverse set of processes. It is a component of the CCR4 complex involved in the control of gene expression.
⇄⧉search_terms => string (1173) "aaa25356 mouse human rat monoclonal igg 2f6 purified by protein a affinity c...
$value[17]['_source']['search_terms']
aaa25356 mouse human rat monoclonal igg 2f6 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with horseradish peroxidase hrp recognizes cnot7 species crossreactivity and elisa eia western blot wb applications are based on unconjugated antibody detection against immunogen 57.46kd aaa25356_wb analysis of expression hela ne aaa25356_wb2 raw 264.7 aaa25356_wb3 nih 3t3 aaa25356_wb4 immunofluorescence if to cell concentration 40ug ml aaa25356_if5 pc 12 aaa25356_wb6 aaa25356_wb7 ccr4 not transcription complex subunit 7 btg1 binding factor 1 associated caf caf1 homo sapiens mrna caf1a hcaf 28,228 da 38174537 bc060852 aah60852 q9uiv1 q7z530 a8mzm5 b3kmp1 b3kn35 d3dsp6 g3v108 antibodies factors full length recombinant corresponding aa1 286 from gst tag mw the alone is 26kd sequence mpaatvdhsqricevwacnldeemkkirqvirkynyvamdtefpgvvarpigefrsnadyqyqllrcnvdllkiiqlgltfmneqgeyppgtstwqfnfkfnltedmyaqdsiellttsgiqfkkheeegietqyfaellmtsgvvlcegvkwlsfhsgydfgylikiltnsnlpeeeldffeilrlffpviydvkylmkscknlkgglqevaeqlelerigpqhqagsdslltgmaffkmremffedhiddakycghlyglgsgssyvqngtgnayeeeankqs conjugate ph7.2 pc12 subunit7 factor1 aa1286
⇄⧉specificity => string (171) "This assay has high sensitivity and excellent specificity for detection of N...
$value[18]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of NEDD9. No significant cross-reactivity or interference between NEDD9 and analogues was observed.
⇄purity => string (3) "N/A"
$value[18]['_source']['purity']
⇄form => string (3) "N/A"
$value[18]['_source']['form']
⇄concentration => string (3) "N/A"
$value[18]['_source']['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value[18]['_source']['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
NEDD9/Enhancer of filamentation 1/hEF1/p105/Renal carcinoma antigen NY-REN-12/Neural precursor cell expressed developmentally down-regulated protein 9/NEDD-9/CRK-associated substrate-related protein/CAS-L/CasL/Cas scaffolding protein family member 2/CASS2/CAS2
⇄products_gene_name => string (5) "NEDD9"
$value[18]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[18]['_source']['products_gene_name_syn']
⇄⧉products_description => string (825) "Principle of the Assay: This kit was based on sandwich enzyme-linked immune-...
$value[18]['_source']['products_description']
Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Capture antibody was pre-coated onto 96-well plates. And the biotin conjugated antibody was used as detection antibodies. The standards, test samples and biotin conjugated detection antibody were added to the wells subsequently, and washed with wash buffer. HRP-Streptavidin was added and unbound conjugates were washed away with wash buffer. TMB substrates were used to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the target amount of sample captured in plate. Read the O.D. absorbance at 450nm in a microplate reader, and then the concentration of target can be calculated.
B Cell Receptor Signaling Pathway||198285!!T Cell Receptor Signaling Pathway||198362!!XPodNet - Protein-protein Interactions In The Podocyte Expanded By STRING Pathway||755427
⇄sp_protein_name => string (27) "Enhancer of filamentation 1"
⇄⧉search_terms => string (624) "aaa17591 human typical testing data aaa17591_td standard curve aaa17591_sc e...
$value[18]['_source']['search_terms']
aaa17591 human typical testing data aaa17591_td standard curve aaa17591_sc elisa kit enhancer of filamentation 1 nedd9 hef1 p105 renal carcinoma antigen ny ren 12 neural precursor cell expressed developmentally down regulated protein 9 nedd crk associated substrate related cas l casl scaffolding family member 2 cass2 cas2 isoform gene mef1 93,052 da casl_mouse 162461098 np_001104794.1 o35177 nm_001111324.2 q8bjl8 q8bk90 q8bl52 q8bm94 q8bmi9 q99ke7 samples serum plasma and other biological fluids assay type sandwich double antibody detection range 0.156 10ng ml sensitivity 0.094ng filamentation1 ren12 protein9 member2
⇄⧉testing_protocols => string (1591) "IHC (Immunohistchemistry)||Immunohistochemistry of paraffin-embedded mouse h...
$value[19]['_source']['testing_protocols']
IHC (Immunohistchemistry)||Immunohistochemistry of paraffin-embedded mouse heart using HDAC2 antibody at dilution of 1:100 (40x lens).||AAA10734_IHC9.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human gastric cancer using HDAC2 antibody at dilution of 1:100 (40x lens).||AAA10734_IHC8.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human esophageal cancer using HDAC2 antibody at dilution of 1:100 (40x lens).||AAA10734_IHC7.jpg!!IHC (Immunohistchemistry)||Immunohistochemistry of paraffin-embedded human prostate cancer using HDAC2 antibody at dilution of 1:100 (40x lens).||AAA10734_IHC6.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human colon carcinoma using HDAC2 antibody at dilution of 1:100 (40x lens).||AAA10734_IHC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human liver cancer using HDAC2 antibody at dilution of 1:100 (40x lens).||AAA10734_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human lung cancer using HDAC2 antibody at dilution of 1:100 (40x lens).||AAA10734_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat kidney using HDAC2 antibody at dilution of 1:100 (40x lens).||AAA10734_IHC2.jpg!!WB (Western Blot)||Western blot analysis of extracts of various cell lines, using HDAC2 antibody at 1:1000 dilution.<br>Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.<br>Lysates/proteins: 25ug per lane.<br>Blocking buffer: 3% nonfat dry milk in TBST.||AAA10734_WB.jpg
