TMEM120A blocking peptide
TMEM120A Peptide - middle region
Gene Names
Tmem120a; Tmpit; 2010310D06Rik
Reactivity
Rat
Synonyms
TMEM120A; TMEM120A Peptide - middle region; TMEM120A blocking peptide
Reactivity
Rat
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: NGLYLSLVLGNVNVTLLSKQAKFAYKDEYEKFKLYLTIILIVISFTCRFL
Sequence Length
343
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for TMEM120A blocking peptide
This is a synthetic peptide designed for use in combination with anti- TMEM120A Antibody, made
Target Description: Necessary for efficient adipogenesis.
Target Description: Necessary for efficient adipogenesis.
Product Categories/Family for TMEM120A blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
41 kDa
NCBI Official Full Name
transmembrane protein 120A
NCBI Official Synonym Full Names
transmembrane protein 120A
NCBI Official Symbol
Tmem120a
NCBI Official Synonym Symbols
Tmpit; 2010310D06Rik
NCBI Protein Information
transmembrane protein 120A
UniProt Protein Name
Transmembrane protein 120A
Protein Family
UniProt Gene Name
Tmem120a
UniProt Synonym Gene Names
Tmpit
UniProt Entry Name
T120A_RAT
Research Articles on TMEM120A
Similar Products
Product Notes
The TMEM120A tmem120a (Catalog #AAA3248426) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The TMEM120A Peptide - middle region reacts with Rat and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: NGLYLSLVLG NVNVTLLSKQ AKFAYKDEYE KFKLYLTIIL IVISFTCRFL. It is sometimes possible for the material contained within the vial of "TMEM120A, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
