Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data

anti-Rat beta endorphin Antibody | anti-POMC antibody

beta endorphin, Antibody, Rabbit

Reactivity
Rat
Applications
Immunofluorescence, Immunohistochemistry
Synonyms
beta endorphin; Antibody; Rabbit; anti-POMC antibody
Ordering
For Research Use Only!
Reactivity
Rat
Sequence Length
31
Applicable Applications for anti-POMC antibody
Immunofluorescence (IF), Immunohistochemistry (IHC)
Type Info
Rabbit IgG
Immunogen
YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
Preparation and Storage
Store at 4-8 degrees

Testing Data

Testing Data

Testing Data

(Images: G-CSF treatment increases the number of migrated b-endorphin-containing PMN cells in injured nerves. (A-C) Confocal laser scanning microscopy of PMN cells and b-endorphin peptides in the right sciatic nerve of vehicle-treated sham rats (A1-3), vehicle-treated CCI rats (B1-3), and G-CSF treated CCI rats (C1-3) 12 h after CCI, respectively. No apparent PMN cells or b-endorphin peptides were observed in the vehicle-treated sham operation rats. However, at 12 h, the count of b-endorphin-containing PMN cells was significantly higher in the G-CSF-treated CCI rats than in the vehicle-treated CCI rats. Scale bar: 100 mum. (D) Confocal high-power field laser scanning pictures showing a PMN cell with a typical segmented nucleus, which stained positive for b-endorphin peptides. Green: PMN cells; red: b-endorphin (END)-containing cells; blue (DAPI): cell nuclei. Scale bar: 10 mum. (E) The number of b-endorphin-containing PMN cells per section as calculated at different time points. The count of b-endorphin-containing PMN cells was higher in the CCI rats treated with G-CSF (black bars) compared to those treated with vehicle (grey bars) between 12-48 h after nerve injury. Data are shown as the means±SEM, n = 5 per group; one-way ANOVA, *p<0.05, **p<0.01: CCI + G-CSF group compared to CCI + vehicle group; #p<0.05, ##p<0.01: CCI + G-CSF or CCI + vehicle group compared to vehicle-treated sham operation control. doi:10.1371/journal.pone.0043680.g004)

Testing Data (Images: G-CSF treatment increases the number of migrated b-endorphin-containing PMN cells in injured nerves. (A-C) Confocal laser scanning microscopy of PMN cells and b-endorphin peptides in the right sciatic nerve of vehicle-treated sham rats (A1-3), vehicle-treated CCI rats (B1-3), and G-CSF treated CCI rats (C1-3) 12 h after CCI, respectively. No apparent PMN cells or b-endorphin peptides were observed in the vehicle-treated sham operation rats. However, at 12 h, the count of b-endorphin-containing PMN cells was significantly higher in the G-CSF-treated CCI rats than in the vehicle-treated CCI rats. Scale bar: 100 mum. (D) Confocal high-power field laser scanning pictures showing a PMN cell with a typical segmented nucleus, which stained positive for b-endorphin peptides. Green: PMN cells; red: b-endorphin (END)-containing cells; blue (DAPI): cell nuclei. Scale bar: 10 mum. (E) The number of b-endorphin-containing PMN cells per section as calculated at different time points. The count of b-endorphin-containing PMN cells was higher in the CCI rats treated with G-CSF (black bars) compared to those treated with vehicle (grey bars) between 12-48 h after nerve injury. Data are shown as the means±SEM, n = 5 per group; one-way ANOVA, *p<0.05, **p<0.01: CCI + G-CSF group compared to CCI + vehicle group; #p<0.05, ##p<0.01: CCI + G-CSF or CCI + vehicle group compared to vehicle-treated sham operation control. doi:10.1371/journal.pone.0043680.g004)
Related Product Information for anti-POMC antibody
b-lipotropin is a 90 amino acid polypeptide that is the carboxy-terminal fragment of POMC. It stimulates melanocytes to produce melanin, and can also be cleaved into smaller peptides. In humans, g-lipotropin, a-MSH, b-MSH, g-MSH, a-endorphin, b-endorphin, g-endorphin, and met-enkephalin are all possible fragments of b-lipotropin. b-lipotropin also performs lipid-mobilizing functions such as lipolysis and steroidogenesis.
Product Categories/Family for anti-POMC antibody

NCBI and Uniprot Product Information

NCBI GI #
Molecular Weight
3,438 Da
NCBI Official Full Name
Beta-endorphin
UniProt Protein Name
Beta-endorphin
Protein Family
UniProt Gene Name
POMC
UniProt Entry Name
COLI_CAMDR

Uniprot Description

Beta-endorphin and Met-enkephalin are endogenous opiates.

Similar Products

Product Notes

The beta endorphin pomc (Catalog #AAA555202) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The beta endorphin, Antibody, Rabbit reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's beta endorphin can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the beta endorphin pomc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "beta endorphin, Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.