Putative DNA repair protein RAD23-2 (RAD23-2) Recombinant Protein | RAD23-2 recombinant protein

Recombinant Arabidopsis thaliana Putative DNA repair protein RAD23-2 (RAD23-2)

Gene Names

RAD23A; RADIATION SENSITIVE23A

Purity

Greater or equal to 85% purity as determined by SDS-PAGE.

Synonyms

Putative DNA repair protein RAD23-2 (RAD23-2); Recombinant Arabidopsis thaliana Putative DNA repair protein RAD23-2 (RAD23-2); RAD23-2 recombinant protein

Ordering
Cat. Num. AAA1315636 When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures. For Research Use Only!

Host

E Coli or Yeast or Baculovirus or Mammalian Cell

Purity/Purification

Greater or equal to 85% purity as determined by SDS-PAGE.

Form/Format

Lyophilized or liquid (Format to be determined during the manufacturing process)

Sequence Positions

1-368, Full length protein

Sequence

MKLTVKTLKGSHFEIRVLPTDTIMAVKKNIEDSQSKDNYPCGQQLLIHNGKVLKDETTLVENKVTEEGFLVVMLSKSKTASSAGPSSTQPTSTTTSTISSTTLAAPSTTQSIAVPASNSTPVQEQPTAQSDTYGQAASTLVSGSSIEQMVQQIMEMGGGSWDKETVTRALRAAYNNPERAVDYLYSGIPETVTIPATNLSGVGSGRELTAPPPSGGPNSSPLDLFPQEAVSDAAGGDLGTLEFLRGNDQFQQLRSMVNSNPQILQPMLQELGKQNPQLLRLIQENQAEFLQLLNEPYEGSDGDVDIFDQPDQEMPHSVNVTPEEQESIERLEAMGFDRAIVIEAFLSCDRNEELAANYLLEHSADFED

Sequence Length

368

Species

Arabidopsis thaliana (Mouse-ear cress)

Preparation and Storage

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #

15221013

NCBI GeneID

838188

NCBI Accession #

NP_173070.1

NCBI GenBank Nucleotide #

NM_101486.3

UniProt Accession #

Q84L32; Q9S9L8; Q9SA20

Molecular Weight

39,626 Da

NCBI Official Full Name

Rad23 UV excision repair protein family

NCBI Official Symbol

RAD23A

NCBI Official Synonym Symbols

RADIATION SENSITIVE23A

NCBI Protein Information

Rad23 UV excision repair protein family

UniProt Protein Name

Probable ubiquitin receptor RAD23a

UniProt Gene Name

RAD23A

UniProt Synonym Gene Names

RAD23; RAD23-2; AtRAD23a; AtRAD23-2

NCBI Description

Encodes a member of the RADIATION SENSITIVE23 (RAD23) family: AT1G16190(RAD23A), AT1G79650(RAD23B), AT3G02540(RAD23C), AT5G38470(RAD23D). RAD23 proteins play an essential role in the cell cycle, morphology, and fertility of plants through their delivery of UPS (ubiquitin/26S proteasome system) substrates to the 26S proteasome.

Uniprot Description

May be involved in nucleotide excision repair (). Binds and presumably selects ubiquitin-conjugates for destruction. Prefers multiubiquitin chains rather than single ubiquitins, with a binding affinity for 'Lys-48'-linked ubiquitin chains. Acts as a ubiquitin receptor that associates with the 26S proteasomal docking subunit RPN10 for the indirect recognition of ubiquitinated substrates of ubiquitin/26S proteasome-mediated proteolysis (UPP) ().

Similar Products

RAD23B Antibody

Host: Rabbit

Reactivity: Human, Mouse, Rat

Apps: Western Blot, Immunohistochemistry

Product Notes

The RAD23-2 rad23a (Catalog #AAA1315636) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-368, Full length protein. The amino acid sequence is listed below: MKLTVKTLKG SHFEIRVLPT DTIMAVKKNI EDSQSKDNYP CGQQLLIHNG KVLKDETTLV ENKVTEEGFL VVMLSKSKTA SSAGPSSTQP TSTTTSTISS TTLAAPSTTQ SIAVPASNST PVQEQPTAQS DTYGQAASTL VSGSSIEQMV QQIMEMGGGS WDKETVTRAL RAAYNNPERA VDYLYSGIPE TVTIPATNLS GVGSGRELTA PPPSGGPNSS PLDLFPQEAV SDAAGGDLGT LEFLRGNDQF QQLRSMVNSN PQILQPMLQE LGKQNPQLLR LIQENQAEFL QLLNEPYEGS DGDVDIFDQP DQEMPHSVNV TPEEQESIER LEAMGFDRAI VIEAFLSCDR NEELAANYLL EHSADFED. It is sometimes possible for the material contained within the vial of "Putative DNA repair protein RAD23-2 (RAD23-2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Loading...