Ras-related C3 botulinum toxin substrate 2 (RAC2) Recombinant Protein | RAC2 recombinant protein

Recombinant Human Ras-related C3 botulinum toxin substrate 2 (RAC2)

Cat. Num. AAA957589

• Gene Names: RAC2; Gx; EN-7; HSPC022; p21-Rac2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Ras-related C3 botulinum toxin substrate 2 (RAC2); Recombinant Human Ras-related C3 botulinum toxin substrate 2 (RAC2); RAC2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-189, Full length protein
• Sequence: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRAC
• Sequence Length: 189

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for RAC2 recombinant protein

This protein is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases.

NCBI and Uniprot Product Information

• NCBI GI #: 4506381
• NCBI GeneID: 5880
• NCBI Accession #: NP_002863.1
• NCBI GenBank Nucleotide #: NM_002872.4
• UniProt Accession #: P15153; Q9UDJ4
• Molecular Weight: 21,429 Da
• NCBI Official Full Name: ras-related C3 botulinum toxin substrate 2
• NCBI Official Synonym Full Names: Rac family small GTPase 2
• NCBI Official Symbol: RAC2
• NCBI Official Synonym Symbols: Gx; EN-7; HSPC022; p21-Rac2
• NCBI Protein Information: ras-related C3 botulinum toxin substrate 2
• UniProt Protein Name: Ras-related C3 botulinum toxin substrate 2
• Protein Family: Ras-related protein
• UniProt Gene Name: RAC2

NCBI Description

This gene encodes a member of the Ras superfamily of small guanosine triphosphate (GTP)-metabolizing proteins. The encoded protein localizes to the plasma membrane, where it regulates diverse processes, such as secretion, phagocytosis, and cell polarization. Activity of this protein is also involved in the generation of reactive oxygen species. Mutations in this gene are associated with neutrophil immunodeficiency syndrome. There is a pseudogene for this gene on chromosome 6. [provided by RefSeq, Jul 2013]

Uniprot Description

Plasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses, such as secretory processes, phagocytose of apoptotic cells and epithelial cell polarization. Augments the production of reactive oxygen species (ROS) by NADPH oxidase.