Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using KEAP1 antibody (MBS127954) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)

Rabbit KEAP1 Antibody | anti-KEAP1 antibody

KEAP Rabbit pAb

Gene Names
KEAP1; INrf2; KLHL19
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
KEAP1; KEAP Rabbit pAb; INrf2; KLHL19; anti-KEAP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
GRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALD
CYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGV
GVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLN
SVERYDVETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRS
GVGVAVTMEPCRKQIDQQNCTC
Applicable Applications for anti-KEAP1 antibody
Western blotting (WB); Immunohistochemistry (IHC); Immunofluorescence (IF)
Application Notes
WB 1:500 - 1:2000
IHC 1:50 - 1:200
IF 1:50 - 1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 325-624 of human KEAP1 (NP_036421.2).
Cellular Location
Cytoplasm, Nucleus
Background
This gene encodes a protein containing KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase. Two alternatively spliced transcript variants encoding the same isoform have been found for this gene.
Preparation and Storage
Store at -20°C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using KEAP1 antibody (MBS127954) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using KEAP1 antibody (MBS127954) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded rat kidney using KEAP1 antibody (MBS127954) at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded rat kidney using KEAP1 antibody (MBS127954) at dilution of 1:100 (40x lens).)

Immunofluorescence (IF)

(Immunofluorescence analysis of A549 cells using KEAP1 antibody (MBS127954).)

Immunofluorescence (IF) (Immunofluorescence analysis of A549 cells using KEAP1 antibody (MBS127954).)
Product Categories/Family for anti-KEAP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated MW: 69kDa
Observed MW: 60KDa
NCBI Official Full Name
Kelch-like ECH-associated protein 1
NCBI Official Synonym Full Names
kelch-like ECH-associated protein 1
NCBI Official Symbol
KEAP1
NCBI Official Synonym Symbols
INrf2; KLHL19
NCBI Protein Information
kelch-like ECH-associated protein 1; kelch-like protein 19; cytosolic inhibitor of Nrf2; kelch-like family member 19
UniProt Protein Name
Kelch-like ECH-associated protein 1
UniProt Gene Name
KEAP1
UniProt Synonym Gene Names
INRF2; KIAA0132; KLHL19; INrf2
UniProt Entry Name
KEAP1_HUMAN

NCBI Description

This gene encodes a protein containing KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase. Two alternatively spliced transcript variants encoding the same isoform have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

KEAP1: a substrate adapter protein for the E3 ubiquitin ligase complex formed by CUL3 and RBX1. Has tumor suppressor activity. Retains NRF2, BPTF and PGAM5 in the cytosol. Targets NRF2 for ubiquitination and degradation by the proteasome, thus resulting in the suppression of its transcriptional activity and of antioxidant response element-mediated detoxifying enzyme gene expression. Somatic mutations of KEAP1 or NRF2 commonly occur in solid cancers, irrespective of histological type, resulting in the constitutive transcription of cytoprotective genes. Genetic disruption of the KEAP1/CUL3 E3 ubiquitin ligase complex leads to the activation of the NF-kappaB pathway in lung cancer. Alternative activation of the cytoprotective NRF2 pathway exist in the absence of mutations in KEAP1 and HRF2: WTX, PALB2, SQSTM1, and DPP3 can competitively bind KEAP1. These proteins and others that bind KEAP1 contain an ¿ETGE¿ amino acid motif, which matches the KEAP1 interaction motif found in NRF2. Binding of these ¿ETGE¿-containing proteins can displace NRF2, freeing it to translocate to the nucleus and implement its cytoprotective transcriptional pathway. The DPP3 gene is frequently overexpressed in squamous cell lung carcinomas with high wt NRF2 activity. Its expression level significantly correlates with the response rate and progression-free survival of platinum-based first-line chemotherapy. May be a useful biomarker for predicting the chemosensitivity of patients with advanced-stage NSCLC. Broadly expressed, with highest levels in skeletal muscle. Ubiquitination and subsequent degradation of PGAM5 is inhibited by oxidative stress and sulforaphane.

Protein type: Ubiquitin conjugating system; Endoplasmic reticulum; Motility/polarity/chemotaxis; Transcription regulation

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: nucleoplasm; endoplasmic reticulum; cytoplasm; microtubule organizing center; midbody; cytosol

Molecular Function: protein binding; transcription factor binding

Biological Process: transcription, DNA-dependent; in utero embryonic development; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; negative regulation of transcription factor activity; proteasomal ubiquitin-independent protein catabolic process; protein ubiquitination; regulation of epidermal cell differentiation

Research Articles on KEAP1

Similar Products

Product Notes

The KEAP1 keap1 (Catalog #AAA127954) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KEAP Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KEAP1 can be used in a range of immunoassay formats including, but not limited to, Western blotting (WB); Immunohistochemistry (IHC); Immunofluorescence (IF). WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200. Researchers should empirically determine the suitability of the KEAP1 keap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GRLIYTAGGY FRQSLSYLEA YNPSDGTWLR LADLQVPRSG LAGCVVGGLL YAVGGRNNSP DGNTDSSALD CYNPMT NQWSPCAPMS VPRNRIGVGV IDGHIYAVGG SHGCIHHNSV ERYEPERDEW HLVAPMLTRR IGV GVA VLNRLLYAVG GFDGTNRLNS AECYYPERNE WRMITAMNTI RSGAGVCVLH NCIYAAGGYD GQDQLN SVERYDVETE TWTFVAPMKH RRSALGITVH QGRIYVLGGY DGHTFLDSVE CYDPDTDTWS EVTRMTSGRS GVGVAV TMEPCRKQID QQNCTC. It is sometimes possible for the material contained within the vial of "KEAP1, Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.