Ras-related protein Rab-34, isoform NARR (RAB34) Recombinant Protein | RAB34 recombinant protein
Recombinant Human Ras-related protein Rab-34, isoform NARR (RAB34)
Gene Names
RAB34; RAH; NARR; RAB39
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ras-related protein Rab-34; isoform NARR (RAB34); Recombinant Human Ras-related protein Rab-34; RAB34 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-198, Full length protein
Sequence
MVGQPQPRDDVGSPRPRVIVGTIRPRVIVGTIRPRVIVGSARARPPPDGTPRPQLAAEESPRPRVIFGTPRARVILGSPRPRVIVSSPWPAVVVASPRPRTPVGSPWPRVVVGTPRPRVIVGSPRARVADADPASAPSQGALQGRRQDEHSGTRAEGSRPGGAAPVPEEGGRFARAQRLPPPRHLRLPGAPDRHRGQI
Sequence Length
198
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
29,044 Da
NCBI Official Full Name
ras-related protein Rab-34 isoform NARR
NCBI Official Synonym Full Names
RAB34, member RAS oncogene family
NCBI Official Symbol
RAB34
NCBI Official Synonym Symbols
RAH; NARR; RAB39
NCBI Protein Information
ras-related protein Rab-34
UniProt Protein Name
Ras-related protein Rab-34, isoform NARR
Protein Family
UniProt Gene Name
RAB34
UniProt Synonym Gene Names
NARR
NCBI Description
This gene encodes a protein belonging to the RAB family of proteins, which are small GTPases involved in protein transport. This family member is a Golgi-bound member of the secretory pathway that is involved in the repositioning of lysosomes and the activation of macropinocytosis. Alternative splicing of this gene results in multiple transcript variants. An alternatively spliced transcript variant produces the nine-amino acid residue-repeats (NARR) protein, which is a functionally distinct nucleolar protein resulting from a different reading frame. [provided by RefSeq, Dec 2016]
Research Articles on RAB34
Similar Products
Product Notes
The RAB34 rab34 (Catalog #AAA1186345) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-198, Full length protein. The amino acid sequence is listed below: MVGQPQPRDD VGSPRPRVIV GTIRPRVIVG TIRPRVIVGS ARARPPPDGT PRPQLAAEES PRPRVIFGTP RARVILGSPR PRVIVSSPWP AVVVASPRPR TPVGSPWPRV VVGTPRPRVI VGSPRARVAD ADPASAPSQG ALQGRRQDEH SGTRAEGSRP GGAAPVPEEG GRFARAQRLP PPRHLRLPGA PDRHRGQI. It is sometimes possible for the material contained within the vial of "Ras-related protein Rab-34, isoform NARR (RAB34), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
