SDS-PAGE
Ras-related protein Rab-31 (RAB31) Recombinant Protein | RAB31 recombinant protein
Recombinant Human Ras-related protein Rab-31 (RAB31)
Gene Names
RAB31; Rab22B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ras-related protein Rab-31 (RAB31); Recombinant Human Ras-related protein Rab-31 (RAB31); Ras-related protein Rab-31; Ras-related protein Rab-22B; RAB31 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-194aa; Full Length
Sequence
MAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC
Sequence Length
194
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for RAB31 recombinant protein
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. Required for the integrity and for normal function of the Golgi apparatus and the trans-Golgi network. Plays a role in insulin-stimulated translocation of GLUT4 to the cell membrane. Plays a role in M6PR transport from the trans-Golgi network to endosomes. Plays a role in the internalization of EGFR from the cell membrane into endosomes. Plays a role in the maturation of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis.
Product Categories/Family for RAB31 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48.6 kDa
NCBI Official Full Name
ras-related protein Rab-31
NCBI Official Synonym Full Names
RAB31, member RAS oncogene family
NCBI Official Symbol
RAB31
NCBI Official Synonym Symbols
Rab22B
NCBI Protein Information
ras-related protein Rab-31; ras-related protein Rab-22B
UniProt Protein Name
Ras-related protein Rab-31
Protein Family
UniProt Gene Name
RAB31
UniProt Synonym Gene Names
RAB22B
UniProt Entry Name
RAB31_HUMAN
NCBI Description
Small GTP-binding proteins of the RAB family, such as RAB31, play essential roles in vesicle and granule targeting (Bao et al., 2002 [PubMed 11784320]).[supplied by OMIM, Jul 2009]
Uniprot Description
RAB31: Belongs to the small GTPase superfamily. Rab family
Protein type: G protein, monomeric; G protein, monomeric, Rab; G protein
Chromosomal Location of Human Ortholog: 18p11.3
Cellular Component: phagocytic vesicle membrane; late endosome; early endosome; trans-Golgi network membrane; phagocytic vesicle
Molecular Function: GTPase activity; GDP binding; GTP binding
Biological Process: regulated secretory pathway; cellular response to insulin stimulus; receptor internalization; Golgi to plasma membrane protein transport; Rab protein signal transduction
Research Articles on RAB31
Similar Products
Product Notes
The RAB31 rab31 (Catalog #AAA1442419) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-194aa; Full Length. The amino acid sequence is listed below: MAIRELKVCL LGDTGVGKSS IVCRFVQDHF DHNISPTIGA SFMTKTVPCG NELHKFLIWD TAGQERFHSL APMYYRGSAA AVIVYDITKQ DSFYTLKKWV KELKEHGPEN IVMAIAGNKC DLSDIREVPL KDAKEYAESI GAIVVETSAK NAINIEELFQ GISRQIPPLD PHENGNNGTI KVEKPTMQAS RRCC. It is sometimes possible for the material contained within the vial of "Ras-related protein Rab-31 (RAB31), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
