Ras-related protein Rab-23 (Rab23) Recombinant Protein | Rab23 recombinant protein
Recombinant Mouse Ras-related protein Rab-23 (Rab23)
Gene Names
Rab23; opb; opb2; AW545388
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ras-related protein Rab-23 (Rab23); Recombinant Mouse Ras-related protein Rab-23 (Rab23); Rab23 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-234, Full length protein
Sequence
MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAISSWREKVVAEVGDIPTALVQNKIDLLDDSCIKNEEAEGLAKRLKLRFYRTSVKEDLNVSEVFKYLAEKHLQKLKQQITEDPEQTHSSSNKIGVFNASVGSHLGQNSSSLNGGDVINLRPNKQRTKRTRNPFSSC
Sequence Length
234
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Rab23 recombinant protein
This protein belongs to the small GTPase superfamily, Rab family. It may be involved in small GTPase mediated signal transduction and intracellular protein transportation. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
26,678 Da
NCBI Official Full Name
Ras-related protein Rab-23
NCBI Official Synonym Full Names
RAB23, member RAS oncogene family
NCBI Official Symbol
Rab23
NCBI Official Synonym Symbols
opb; opb2; AW545388
NCBI Protein Information
ras-related protein Rab-23
UniProt Protein Name
Ras-related protein Rab-23
Protein Family
UniProt Gene Name
Rab23
UniProt Synonym Gene Names
Opb
Uniprot Description
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion (). Plays a role in autophagic vacuole assembly, and mediates defense against pathogens, such as S.aureus, by promoting their capture by autophagosomes that then merge with lysosomes (). Together with SUFU, prevents nuclear import of GLI1, and thereby inhibits GLI1 transcription factor activity. Regulates GLI1 in differentiating chondrocytes. Likewise, regulates GLI3 proteolytic processing and modulates GLI2 and GLI3 transcription factor activity.
Research Articles on Rab23
Similar Products
Product Notes
The Rab23 rab23 (Catalog #AAA968467) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-234, Full length protein. The amino acid sequence is listed below: MLEEDMEVAI KMVVVGNGAV GKSSMIQRYC KGIFTKDYKK TIGVDFLERQ IQVNDEDVRL MLWDTAGQEE FDAITKAYYR GAQACVLVFS TTDRESFEAI SSWREKVVAE VGDIPTALVQ NKIDLLDDSC IKNEEAEGLA KRLKLRFYRT SVKEDLNVSE VFKYLAEKHL QKLKQQITED PEQTHSSSNK IGVFNASVGS HLGQNSSSLN GGDVINLRPN KQRTKRTRNP FSSC. It is sometimes possible for the material contained within the vial of "Ras-related protein Rab-23 (Rab23), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
