SDS-PAGE
ATP-dependent (S)-NAD(P)H-hydrate dehydratase Recombinant Protein | R107.2 recombinant protein
Recombinant Caenorhabditis elegans ATP-dependent (S)-NAD(P)H-hydrate dehydratase
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP-dependent (S)-NAD(P)H-hydrate dehydratase; Recombinant Caenorhabditis elegans ATP-dependent (S)-NAD(P)H-hydrate dehydratase; ATP-dependent NAD(P)HX dehydratase; R107.2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-307aa; Full Length
Sequence
MDHFIKLLPKLTPHLRKGDCGKMGVIGGSLEYTGAPYFAASSASRLGADLIHIFCDPDAAQVIKGYSPDLIVHPGMTANSIIPKLSRMDAIVIGPGLGRNPNIWPLMQELFEFVRNRDVPFVIDGDGLWFVSEHIEKFPRQMSATVLTPNIVEFSRLCKSALGEEDVLNVRNNSQLQHLAAELSRKMNVTIYLKGEVDLVVTPNGEVSKCSTESSLRRCGGQGDVTAGSLGLFLYWAKKNLGDDWTSAHHEAGIASSWLVRTAGRRAFEKHGRSMNTPLLLDEIPKLVRDVETREMKDTVHTDSSKH
Sequence Length
307
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for R107.2 recombinant protein
Catalyzes the dehydration of the S-form of NAD(P)HX at the expense of ATP, which is converted to ADP. Together with NAD(P)HX epimerase, which catalyzes the epimerization of the S- and R-forms, the enzyme allows the repair of both epimers of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration.
References
2.2 Mb of contiguous nucleotide sequence from chromosome III of C. elegans.Wilson R., Ainscough R., Anderson K., Baynes C., Berks M., Bonfield J., Burton J., Connell M., Copsey T., Cooper J., Coulson A., Craxton M., Dear S., Du Z., Durbin R., Favello A., Fraser A., Fulton L., Gardner A., Green P., Hawkins T., Hillier L., Jier M., Johnston L., Jones M., Kershaw J., Kirsten J., Laisster N., Latreille P., Lightning J., Lloyd C., Mortimore B., O'Callaghan M., Parsons J., Percy C., Rifken L., Roopra A., Saunders D., Shownkeen R., Sims M., Smaldon N., Smith A., Smith M., Sonnhammer E., Staden R., Sulston J., Thierry-Mieg J., Thomas K., Vaudin M., Vaughan K., Waterston R., Watson A., Weinstock L., Wilkinson-Sproat J., Wohldman P.Nature 368:32-38(1994)
Genome sequence of the nematode C. elegans
a platform for investigating biology.The C. elegans sequencing consortiumScience 282:2012-2018(1998)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35.9 kDa
NCBI Official Full Name
ATP-dependent (S)-NAD(P)H-hydrate dehydratase
NCBI Official Symbol
R107.2
NCBI Protein Information
ATP-dependent (S)-NAD(P)H-hydrate dehydratase
UniProt Protein Name
ATP-dependent (S)-NAD(P)H-hydrate dehydratase
Protein Family
UniProt Gene Name
R107.2
UniProt Entry Name
NNRD_CAEEL
Uniprot Description
Catalyzes the dehydration of the S-form of NAD(P)HX at the expense of ATP, which is converted to ADP. Together with NAD(P)HX epimerase, which catalyzes the epimerization of the S- and R-forms, the enzyme allows the repair of both epimers of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration.
Similar Products
Product Notes
The R107.2 r107.2 (Catalog #AAA1106874) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-307aa; Full Length. The amino acid sequence is listed below: MDHFIKLLPK LTPHLRKGDC GKMGVIGGSL EYTGAPYFAA SSASRLGADL IHIFCDPDAA QVIKGYSPDL IVHPGMTANS IIPKLSRMDA IVIGPGLGRN PNIWPLMQEL FEFVRNRDVP FVIDGDGLWF VSEHIEKFPR QMSATVLTPN IVEFSRLCKS ALGEEDVLNV RNNSQLQHLA AELSRKMNVT IYLKGEVDLV VTPNGEVSKC STESSLRRCG GQGDVTAGSL GLFLYWAKKN LGDDWTSAHH EAGIASSWLV RTAGRRAFEK HGRSMNTPLL LDEIPKLVRD VETREMKDTV HTDSSKH. It is sometimes possible for the material contained within the vial of "ATP-dependent (S)-NAD(P)H-hydrate dehydratase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
