Probable quinate dehydrogenase (quinone) (qumA) Recombinant Protein | qumA recombinant protein
Recombinant Xanthomonas campestris pv. juglandis Probable quinate dehydrogenase (quinone) (qumA)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable quinate dehydrogenase (quinone) (qumA); Recombinant Xanthomonas campestris pv. juglandis Probable quinate dehydrogenase (quinone) (qumA); qumA recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-790aa; full length protein
Sequence
MLIALVGLIFLLGGARLASLGGSWYFLLMGLATALAGVLIVLRRPAGALVYGVAFALTLV WALWDAGLEFWPLVSRLMLPAAFAVLVALAWPALRRSRALPTGRTAYGVATVLALAVVAG IGGMFVPHPPVAGNAGPGMTAVPPGSVQQNWSAYGNTDGGSRFAALDQINRSNGRPAAGS PGPTTPGEIANSDGNGAEDQLTPLQVGEKVFLCTPHNNLIALDASTGKQLWRREINATSS VWQRCRGLGYFDADAALPAPSVANPSPIAAVTVAQGANCRRRLFTNTIDGRLIAVDADTG AFCQGFGSNGQVDLKAGLGAAPDPFYQLTSPPLVAGTTVVGGRTRADDNVQTDMPGGVVR GSMWSPVRSAGLDPGNPHDRQAPAAGSSYVRSTPNVWAPMSYDAAMNTVFLPLGGPSTDL YGAERTALDHRYGASVLALDATTGAEKWVYQTVHNDLWDFDLPMQPSLIDFPNQDGSHTP AVVIGTKAGQIYVLDRATGKPLTEVREVPVKGSDIAHEQYAPTQPLSVGMPQIGTKHLTE SDMWGATAMDQMLCRIAFKQMRYEGLYTAPGTDVSLSFPGSLGGMNWGGLSTDPVHDVVF ANDMRLGLWVQMIPADTRKAEAAGGGEAVNTGMGAVPLKGTPYAVNKNRFLSALGIPCQA PPYGTLSAIDLKTRSIAWQVPVGTVQDTGPFGIKMHLPIPIGMPTLGGTLSTQGGLVFIA GTQDYYLRAFDSATGKELWKGRLPVGSQGGPITYVSHKTGKQYVVISAGGARQSPDRGDY VIAYSLPDAH
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Xanthomonas campestris pv. juglandis (Xanthomonas arboricola pv. juglandis)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for qumA recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
82,897 Da
NCBI Official Full Name
Probable quinate dehydrogenase (quinone)
UniProt Protein Name
Probable quinate dehydrogenase (quinone)
Protein Family
UniProt Gene Name
qumA
UniProt Entry Name
QUIA_XANCJ
Similar Products
Product Notes
The qumA quma (Catalog #AAA7028408) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-790aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the qumA quma for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLIALVGLIF LLGGARLASL GGSWYFLLMG LATALAGVLI VLRRPAGALV YGVAFALTLV WALWDAGLEF WPLVSRLMLP AAFAVLVALA WPALRRSRAL PTGRTAYGVA TVLALAVVAG IGGMFVPHPP VAGNAGPGMT AVPPGSVQQN WSAYGNTDGG SRFAALDQIN RSNGRPAAGS PGPTTPGEIA NSDGNGAEDQ LTPLQVGEKV FLCTPHNNLI ALDASTGKQL WRREINATSS VWQRCRGLGY FDADAALPAP SVANPSPIAA VTVAQGANCR RRLFTNTIDG RLIAVDADTG AFCQGFGSNG QVDLKAGLGA APDPFYQLTS PPLVAGTTVV GGRTRADDNV QTDMPGGVVR GSMWSPVRSA GLDPGNPHDR QAPAAGSSYV RSTPNVWAPM SYDAAMNTVF LPLGGPSTDL YGAERTALDH RYGASVLALD ATTGAEKWVY QTVHNDLWDF DLPMQPSLID FPNQDGSHTP AVVIGTKAGQ IYVLDRATGK PLTEVREVPV KGSDIAHEQY APTQPLSVGM PQIGTKHLTE SDMWGATAMD QMLCRIAFKQ MRYEGLYTAP GTDVSLSFPG SLGGMNWGGL STDPVHDVVF ANDMRLGLWV QMIPADTRKA EAAGGGEAVN TGMGAVPLKG TPYAVNKNRF LSALGIPCQA PPYGTLSAID LKTRSIAWQV PVGTVQDTGP FGIKMHLPIP IGMPTLGGTL STQGGLVFIA GTQDYYLRAF DSATGKELWK GRLPVGSQGG PITYVSHKTG KQYVVISAGG ARQSPDRGDY VIAYSLPDAH. It is sometimes possible for the material contained within the vial of "Probable quinate dehydrogenase (quinone) (qumA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
