Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Pyroglutamylated RFamide peptide receptor (QRFPR) Recombinant Protein | QRFPR recombinant protein

Recombinant Human Pyroglutamylated RFamide peptide receptor (QRFPR)

Gene Names
QRFPR; AQ27; GPR103; SP9155
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Pyroglutamylated RFamide peptide receptor (QRFPR); Recombinant Human Pyroglutamylated RFamide peptide receptor (QRFPR); QRFPR recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-431aa; full length protein
Sequence
MQALNITPEQFSRLLRDHNLTREQFIALYRLRPLVYTPELPGRAKLALVLTGVLIFALAL FGNALVFYVVTRSKAMRTVTNIFICSLALSDLLITFFCIPVTMLQNISDNWLGGAFICKM VPFVQSTAVVTEILTMTCIAVERHQGLVHPFKMKWQYTNRRAFTMLGVVWLVAVIVGSPM WHVQQLEIKYDFLYEKEHICCLEEWTSPVHQKIYTTFILVILFLLPLMVMLILYSKIGYE LWIKKRVGDGSVLRTIHGKEMSKIARKKKRAVIMMVTVVALFAVCWAPFHVVHMMIEYSN FEKEYDDVTIKMIFAIVQIIGFSNSICNPIVYAFMNENFKKNVLSAVCYCIVNKTFSPAQ RHGNSGITMMRKKAKFSLRENPVEETKGEAFSDGNIEVKLCEQTEEKKKLKRHLALFRSE LAENSPLDSGH
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for QRFPR recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,488 Da
NCBI Official Full Name
pyroglutamylated RFamide peptide receptor
NCBI Official Synonym Full Names
pyroglutamylated RFamide peptide receptor
NCBI Official Symbol
QRFPR
NCBI Official Synonym Symbols
AQ27; GPR103; SP9155
NCBI Protein Information
pyroglutamylated RFamide peptide receptor
UniProt Protein Name
Pyroglutamylated RFamide peptide receptor
UniProt Gene Name
QRFPR
UniProt Synonym Gene Names
GPR103
UniProt Entry Name
QRFPR_HUMAN

Uniprot Description

GPR103: Receptor for the orexigenic neuropeptide QRFP. The activity of this receptor is mediated by G proteins that modulate adenylate cyclase activity and intracellular calcium levels. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; GPCR, family 1; Receptor, GPCR

Chromosomal Location of Human Ortholog: 4q27

Cellular Component: integral to membrane; integral to plasma membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; neuropeptide Y receptor activity; peptide binding

Biological Process: cellular response to hormone stimulus; G-protein coupled receptor protein signaling pathway; neuropeptide signaling pathway

Research Articles on QRFPR

Similar Products

Product Notes

The QRFPR qrfpr (Catalog #AAA7028391) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-431aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the QRFPR qrfpr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MQALNITPEQ FSRLLRDHNL TREQFIALYR LRPLVYTPEL PGRAKLALVL TGVLIFALAL FGNALVFYVV TRSKAMRTVT NIFICSLALS DLLITFFCIP VTMLQNISDN WLGGAFICKM VPFVQSTAVV TEILTMTCIA VERHQGLVHP FKMKWQYTNR RAFTMLGVVW LVAVIVGSPM WHVQQLEIKY DFLYEKEHIC CLEEWTSPVH QKIYTTFILV ILFLLPLMVM LILYSKIGYE LWIKKRVGDG SVLRTIHGKE MSKIARKKKR AVIMMVTVVA LFAVCWAPFH VVHMMIEYSN FEKEYDDVTI KMIFAIVQII GFSNSICNPI VYAFMNENFK KNVLSAVCYC IVNKTFSPAQ RHGNSGITMM RKKAKFSLRE NPVEETKGEA FSDGNIEVKL CEQTEEKKKL KRHLALFRSE LAENSPLDSG H. It is sometimes possible for the material contained within the vial of "Pyroglutamylated RFamide peptide receptor (QRFPR), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.