Quaternary ammonium compound-resistance protein qacE (qacE) Recombinant Protein | qacE recombinant protein
Recombinant Enterobacter aerogenes Quaternary ammonium compound-resistance protein qacE (qacE)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Quaternary ammonium compound-resistance protein qacE (qacE); Recombinant Enterobacter aerogenes Quaternary ammonium compound-resistance protein qacE (qacE); qacE recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-110
Sequence
MKGWLFLVIAIVGEVIATSALKSSEGFTKLAPSAVVIIGYGIAFYFLSLVLKSIPVGVAYAVWSGLGVVIITAIAWLLHGQKLDAWGFVGMGLIVSGVVVLNLLSKASAH
Sequence Length
110
Species
Enterobacter aerogenes (Aerobacter aerogenes)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for qacE recombinant protein
qacE
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
11,472 Da
NCBI Official Full Name
QacE
NCBI Official Symbol
qacE
NCBI Protein Information
QacE
UniProt Protein Name
Quaternary ammonium compound-resistance protein QacE
Protein Family
UniProt Gene Name
qacE
UniProt Entry Name
QACE_ENTAE
Uniprot Description
Function: Multidrug exporter. Is implicated for the resistance to bacteriocidal quaternary ammonium compounds
By similarity.
Subcellular location: Cell membrane; Multi-pass membrane protein
Potential.
Sequence similarities: Belongs to the small multidrug resistance (SMR) protein family.
Similar Products
Product Notes
The qacE qace (Catalog #AAA1187887) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-110. The amino acid sequence is listed below: MKGWLFLVIA IVGEVIATSA LKSSEGFTKL APSAVVIIGY GIAFYFLSLV LKSIPVGVAY AVWSGLGVVI ITAIAWLLHG QKLDAWGFVG MGLIVSGVVV LNLLSKASAH. It is sometimes possible for the material contained within the vial of "Quaternary ammonium compound-resistance protein qacE (qacE), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
