Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Abscisic acid receptor PYL5 (PYL5) Recombinant Protein | PYL5 recombinant protein

Recombinant Arabidopsis thaliana Abscisic acid receptor PYL5 (PYL5)

Gene Names
PYL5; AtPYL5; K18I23.25; K18I23_25; PYRABACTIN RESISTANCE 1-LIKE 5; RCAR8; regulatory component of ABA receptor 8
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Abscisic acid receptor PYL5 (PYL5); Recombinant Arabidopsis thaliana Abscisic acid receptor PYL5 (PYL5); PYL5 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-203, Full length protein
Sequence
MRSPVQLQHGSDATNGFHTLQPHDQTDGPIKRVCLTRGMHVPEHVAMHHTHDVGPDQCCSSVVQMIHAPPESVWALVRRFDNPKVYKNFIRQCRIVQGDGLHVGDLREVMVVSGLPAVSSTERLEILDEERHVISFSVVGGDHRLKNYRSVTTLHASDDEGTVVVESYIVDVPPGNTEEETLSFVDTIVRCNLQSLARSTNRQ
Sequence Length
203
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,662 Da
NCBI Official Full Name
Polyketide cyclase/dehydrase and lipid transport superfamily protein
NCBI Official Symbol
PYL5
NCBI Official Synonym Symbols
AtPYL5; K18I23.25; K18I23_25; PYRABACTIN RESISTANCE 1-LIKE 5; RCAR8; regulatory component of ABA receptor 8
NCBI Protein Information
Polyketide cyclase/dehydrase and lipid transport superfamily protein
UniProt Protein Name
Abscisic acid receptor PYL5
Protein Family
UniProt Gene Name
PYL5
UniProt Synonym Gene Names
ABIP3; RCAR8

NCBI Description

Encodes a member of the PYR (pyrabactin resistance)/PYL(PYR1-like)/RCAR (regulatory components of ABA receptor) family proteins with 14 members. PYR/PYL/RCAR family proteins function as abscisic acid sensors. Mediate ABA-dependent regulation of protein phosphatase 2Cs ABI1 and ABI2.

Uniprot Description

Receptor for abscisic acid (ABA) required for ABA-mediated responses such as stomatal closure and germination inhibition. Inhibits the activity of group-A protein phosphatases type 2C (PP2Cs) in an ABA-independent manner but more efficiently when activated by ABA. Confers enhanced sensitivity to ABA (PubMed:19407143, PubMed:19624469, PubMed:23844015, PubMed:21658606). Can be activated by both (-)-ABA and (+)-ABA (PubMed:23844015).

Research Articles on PYL5

Similar Products

Product Notes

The PYL5 pyl5 (Catalog #AAA1428628) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-203, Full length protein. The amino acid sequence is listed below: MRSPVQLQHG SDATNGFHTL QPHDQTDGPI KRVCLTRGMH VPEHVAMHHT HDVGPDQCCS SVVQMIHAPP ESVWALVRRF DNPKVYKNFI RQCRIVQGDG LHVGDLREVM VVSGLPAVSS TERLEILDEE RHVISFSVVG GDHRLKNYRS VTTLHASDDE GTVVVESYIV DVPPGNTEEE TLSFVDTIVR CNLQSLARST NRQ. It is sometimes possible for the material contained within the vial of "Abscisic acid receptor PYL5 (PYL5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.