Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Poliovirus receptor-related protein 2 (PVRL2) Recombinant Protein | PVRL2 recombinant protein

Recombinant Human Poliovirus receptor-related protein 2 (PVRL2)

Gene Names
PVRL2; HVEB; PRR2; CD112; PVRR2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Poliovirus receptor-related protein 2 (PVRL2); Recombinant Human Poliovirus receptor-related protein 2 (PVRL2); Poliovirus receptor-related protein 2; Herpes virus entry mediator B; Herpesvirus entry mediator B; HveB; Nectin-2; CD_antigen=; CD112; PVRL2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
32-360aa; Extracellular Domain
Sequence
QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGG
Sequence Length
360
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for PVRL2 recombinant protein
Probable cell adhesion protein.
Product Categories/Family for PVRL2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39.2 kDa
NCBI Official Full Name
nectin-2 isoform delta
NCBI Official Synonym Full Names
poliovirus receptor-related 2 (herpesvirus entry mediator B)
NCBI Official Symbol
PVRL2
NCBI Official Synonym Symbols
HVEB; PRR2; CD112; PVRR2
NCBI Protein Information
nectin-2; poliovirus receptor-like 2; herpesvirus entry protein B
UniProt Protein Name
Nectin-2
UniProt Gene Name
PVRL2
UniProt Synonym Gene Names
HVEB; PRR2; Herpesvirus entry mediator B; HveB
UniProt Entry Name
PVRL2_HUMAN

NCBI Description

This gene encodes a single-pass type I membrane glycoprotein with two Ig-like C2-type domains and an Ig-like V-type domain. This protein is one of the plasma membrane components of adherens junctions. It also serves as an entry for certain mutant strains of herpes simplex virus and pseudorabies virus, and it is involved in cell to cell spreading of these viruses. Variations in this gene have been associated with differences in the severity of multiple sclerosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

nectin 2: Probable cell adhesion protein. Belongs to the nectin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell adhesion; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.2

Cellular Component: focal adhesion; cell surface; integral to membrane; plasma membrane; intercellular junction; zonula adherens

Molecular Function: viral receptor activity; identical protein binding; protein binding; protein homodimerization activity; coreceptor activity; cell adhesion molecule binding

Biological Process: acrosome formation; establishment of mitochondrion localization; intercellular junction assembly and maintenance; regulation of immune response; sperm mitochondrion organization and biogenesis; positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target; positive regulation of immunoglobulin mediated immune response; spermatid nuclear differentiation; cytoskeleton organization and biogenesis; susceptibility to natural killer cell mediated cytotoxicity; positive regulation of natural killer cell mediated cytotoxicity; virion attachment, binding of host cell surface coreceptor; signal transduction; positive regulation of mast cell activation; viral envelope fusion with host membrane; fertilization; cell part morphogenesis; adhesion to host; homophilic cell adhesion; spermatid development

Research Articles on PVRL2

Similar Products

Product Notes

The PVRL2 pvrl2 (Catalog #AAA1320948) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 32-360aa; Extracellular Domain. The amino acid sequence is listed below: QDVRVQVLPE VRGQLGGTVE LPCHLLPPVP GLYISLVTWQ RPDAPANHQN VAAFHPKMGP SFPSPKPGSE RLSFVSAKQS TGQDTEAELQ DATLALHGLT VEDEGNYTCE FATFPKGSVR GMTWLRVIAK PKNQAEAQKV TFSQDPTTVA LCISKEGRPP ARISWLSSLD WEAKETQVSG TLAGTVTVTS RFTLVPSGRA DGVTVTCKVE HESFEEPALI PVTLSVRYPP EVSISGYDDN WYLGRTDATL SCDVRSNPEP TGYDWSTTSG TFPTSAVAQG SQLVIHAVDS LFNTTFVCTV TNAVGMGRAE QVIFVRETPN TAGAGATGG. It is sometimes possible for the material contained within the vial of "Poliovirus receptor-related protein 2 (PVRL2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.