Putative mannose 6-phosphate receptor-like protein C530.09c (SPBC530.09c) Recombinant Protein | SPBC530.09c recombinant protein
Recombinant Schizosaccharomyces pombe Putative mannose 6-phosphate receptor-like protein C530.09c (SPBC530.09c)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative mannose 6-phosphate receptor-like protein C530.09c (SPBC530.09c); Recombinant Schizosaccharomyces pombe Putative mannose 6-phosphate receptor-like protein C530.09c (SPBC530.09c); Recombinant Putative mannose 6-phosphate receptor-like protein C530.09c (SPBC530.09c); Putative mannose 6-phosphate receptor-like protein C530.09c; SPBC530.09c recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
26-296
Sequence
LTITRRGFKVQESDEEPFCALHHPNTGEYFDLSGLIRDNTSEKGDYSVNGYDFGTNFSINLCHPVVSNLTNYTVEGDVSSEDSIGGFFTVEDDDLYSIGQAAYKPYFRGKKLIMQLDNGSLCPKSNHIRMSTLISFTCNRDPYTAPSVITYVGNLNDCAFFFEWKTIHACPTVKKDSTLNPVSVFLLFCAIAFLAYFVGGFVYQRVVLNARGLRQIPNYEMWRSLFGFISDIVIILYSSILSILPSSITRMRGNRRNIDYVEDALIDDIDT
Sequence Length
296
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,404 Da
NCBI Official Full Name
cation dependent mannose-6-phosphate cargo receptor (predicted)
NCBI Official Symbol
SPBC530.09c
NCBI Protein Information
cation dependent mannose-6-phosphate cargo receptor (predicted)
UniProt Protein Name
Putative mannose 6-phosphate receptor-like protein C530.09c
Protein Family
UniProt Entry Name
YN29_SCHPO
Uniprot Description
Subcellular location: Golgi apparatus › trans-Golgi network membrane; Multi-pass membrane protein. Endosome membrane; Multi-pass membrane protein
Potential Ref.2.
Sequence similarities: Belongs to the MRL1/IGF2R family.
Similar Products
Product Notes
The SPBC530.09c (Catalog #AAA1197251) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-296. The amino acid sequence is listed below: LTITRRGFKV QESDEEPFCA LHHPNTGEYF DLSGLIRDNT SEKGDYSVNG YDFGTNFSIN LCHPVVSNLT NYTVEGDVSS EDSIGGFFTV EDDDLYSIGQ AAYKPYFRGK KLIMQLDNGS LCPKSNHIRM STLISFTCNR DPYTAPSVIT YVGNLNDCAF FFEWKTIHAC PTVKKDSTLN PVSVFLLFCA IAFLAYFVGG FVYQRVVLNA RGLRQIPNYE MWRSLFGFIS DIVIILYSSI LSILPSSITR MRGNRRNIDY VEDALIDDID T. It is sometimes possible for the material contained within the vial of "Putative mannose 6-phosphate receptor-like protein C530.09c (SPBC530.09c), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
