SDS-PAGE
Polar tube protein 3 Nosema bombycis Recombinant Protein | PTP3 recombinant protein
Polar tube protein 3 Nosema bombycis (Microsporidian parasite)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Polar tube protein 3 Nosema bombycis; Polar tube protein 3 Nosema bombycis (Microsporidian parasite); PTP3 recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
710-1320aa; Partial
Sequence
DEYSIDRSVIKFPLKTFIDEEVSNVGEAYVKNKKQSINDEVRNKVTTTNVNSGLNVIETENGFLNLGENSKKIHIDEATAYFKPAAKLKMEKKGIKTDNFRPKTNQGEIRDMPKGETYYEVDLKDADLSLPSPTNPTPDTLVSNGKDVVDVEDVSAIVINKGTLVQTPWNEYSDMIKPKFNPYPNEGEKINQIKKLQKLIADEKRKDTLDRIKVNTITNPDGEKRMIVNTPYGVQEMFEETEGMKRLSHIDPNKNVAISETPTDDNKESIYSAFKNVSPNEAVGKFIEDTFNSAYSSGQAQRFVNPTNAFTGQEDPKKARLMTQKTIDVTEYYINDGKPSSAIKNQLIQNYRALADSLGMTEEDFIQFARKIPDDSLAQMISYNEQSESSRPALVDAPFFKTLQPLANQTSKTKLNDIIKIIFTQISKVTGKTNSTTGTTLEKKIVPNLKAVRSDQVIAGPNGGTSALSQATAPRTGSTVLSKQITRGLPRVPSGTGTSYPVRDPNGINTSEDNERYKVNPYNPYSKSDTSGLEAPGGEIVHNGTRPSPYAIVGVPIVAAVTTPVIRPAVLRTPPAAQSSSSALQGNTALTGAGTPRAGVAGSPGVNPGPT
Sequence Length
1,370
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Product Categories/Family for PTP3 recombinant protein
References
Comparative genomics of parasitic silkworm microsporidia reveal an association between genome expansion and host adaptation.Pan G., Xu J., Li T., Xia Q., Liu S.L., Zhang G., Li S., Li C., Liu H., Yang L., Liu T., Zhang X., Wu Z., Fan W., Dang X., Xiang H., Tao M., Li Y., Hu J., Li Z., Lin L., Luo J., Geng L., Wang L., Long M., Wan Y., He N., Zhang Z., Lu C., Keeling P.J., Wang J., Xiang Z., Zhou Z.BMC Genomics 14:186-186(2013)
NCBI and Uniprot Product Information
UniProt Accession #
Molecular Weight
95.9 kDa
UniProt Protein Name
Polar tube protein 3
Protein Family
UniProt Gene Name
PTP3
UniProt Entry Name
R0KX08_NOSB1
Similar Products
Product Notes
The PTP3 ptp3 (Catalog #AAA1265354) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 710-1320aa; Partial. The amino acid sequence is listed below: DEYSIDRSVI KFPLKTFIDE EVSNVGEAYV KNKKQSINDE VRNKVTTTNV NSGLNVIETE NGFLNLGENS KKIHIDEATA YFKPAAKLKM EKKGIKTDNF RPKTNQGEIR DMPKGETYYE VDLKDADLSL PSPTNPTPDT LVSNGKDVVD VEDVSAIVIN KGTLVQTPWN EYSDMIKPKF NPYPNEGEKI NQIKKLQKLI ADEKRKDTLD RIKVNTITNP DGEKRMIVNT PYGVQEMFEE TEGMKRLSHI DPNKNVAISE TPTDDNKESI YSAFKNVSPN EAVGKFIEDT FNSAYSSGQA QRFVNPTNAF TGQEDPKKAR LMTQKTIDVT EYYINDGKPS SAIKNQLIQN YRALADSLGM TEEDFIQFAR KIPDDSLAQM ISYNEQSESS RPALVDAPFF KTLQPLANQT SKTKLNDIIK IIFTQISKVT GKTNSTTGTT LEKKIVPNLK AVRSDQVIAG PNGGTSALSQ ATAPRTGSTV LSKQITRGLP RVPSGTGTSY PVRDPNGINT SEDNERYKVN PYNPYSKSDT SGLEAPGGEI VHNGTRPSPY AIVGVPIVAA VTTPVIRPAV LRTPPAAQSS SSALQGNTAL TGAGTPRAGV AGSPGVNPGP T. It is sometimes possible for the material contained within the vial of "Polar tube protein 3 Nosema bombycis, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
