Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Prostaglandin reductase 1 (Ptgr1) Recombinant Protein | Ptgr1 recombinant protein

Recombinant Guinea pig Prostaglandin reductase 1 (Ptgr1)

Gene Names
Ptgr1; Ltb4dh
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Prostaglandin reductase 1 (Ptgr1); Recombinant Guinea pig Prostaglandin reductase 1 (Ptgr1); Ptgr1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-329, Full length protein
Sequence
MVKAKSWTLKKHFQGKPTQSDFELKTVELPPLKNGEVLLEALFLSVDPYMRIASKRLKEGAVMMGQQVARVVESKNSAFPAGSIVLAQSGWTTHFISDGKGLEKLLTEWPDKLPLSLALGTIGMPGLTAYFGLLEVCGVKGGETVLVSAAAGAVGSVVGQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNSLEEALKKASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISVYNRMDQLPPGPSPESIIYKQLRIEGFIVYRWQGDVREKALRDLMKWVLEGKIQYHEHVTKGFENMPAAFIEMLNGANLGKAVVTA
Sequence Length
329
Species
Cavia porcellus (Guinea pig)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Ptgr1 recombinant protein
This gene encodes an enzyme that is involved in the inactivation of the chemotactic factor, leukotriene B4. The encoded protein specifically catalyzes the NADP+ dependent conversion of leukotriene B4 to 12-oxo-leukotriene B4. A pseudogene of this gene is found on chromosome 1. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,730 Da
NCBI Official Full Name
prostaglandin reductase 1
NCBI Official Symbol
Ptgr1
NCBI Official Synonym Symbols
Ltb4dh
NCBI Protein Information
prostaglandin reductase 1
UniProt Protein Name
Prostaglandin reductase 1
Protein Family
UniProt Gene Name
Ptgr1
UniProt Synonym Gene Names
Ltb4dh; PRG-1; PGR; 12-HD; LTB4

Uniprot Description

Functions as 15-oxo-prostaglandin 13-reductase and acts on 15-oxo-PGE1, 15-oxo-PGE2 and 15-oxo-PGE2-alpha. Catalyzes the conversion of leukotriene B4 into its biologically less active metabolite, 12-oxo-leukotriene B4. This is an initial and key step of metabolic inactivation of leukotriene B4.

Similar Products

Product Notes

The Ptgr1 ptgr1 (Catalog #AAA1380592) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-329, Full length protein. The amino acid sequence is listed below: MVKAKSWTLK KHFQGKPTQS DFELKTVELP PLKNGEVLLE ALFLSVDPYM RIASKRLKEG AVMMGQQVAR VVESKNSAFP AGSIVLAQSG WTTHFISDGK GLEKLLTEWP DKLPLSLALG TIGMPGLTAY FGLLEVCGVK GGETVLVSAA AGAVGSVVGQ IAKLKGCKVV GAAGSDEKIA YLKQIGFDAA FNYKTVNSLE EALKKASPDG YDCYFDNVGG EFLNTVLSQM KDFGKIAICG AISVYNRMDQ LPPGPSPESI IYKQLRIEGF IVYRWQGDVR EKALRDLMKW VLEGKIQYHE HVTKGFENMP AAFIEMLNGA NLGKAVVTA. It is sometimes possible for the material contained within the vial of "Prostaglandin reductase 1 (Ptgr1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.