Prostaglandin E Synthase 3 (PTGES3) Recombinant Protein | PTGES3 recombinant protein

Recombinant Human Prostaglandin E Synthase 3 (PTGES3)

Cat. Num. AAA7115307

• Gene Names: PTGES3; P23; TEBP; cPGES
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Prostaglandin E Synthase 3 (PTGES3); Recombinant Human Prostaglandin E Synthase 3 (PTGES3); Cytosolic prostaglandin E2 synthase; cPGES; Hsp90 co-chaperone; Progesterone receptor complex p23; Telomerase-binding protein p23; PTGES3 recombinant protein

• Host: Yeast
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-160aa; Full length
• Sequence: MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
• Sequence Length: 160

• Species: Human
• Tag: N-terminal 10xHis-tagged
• Subcellular Location: Cytoplasm
• Protein Families: P23/wos2 family
• Production Note: Special Offer: The Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-Page

Related Product Information for PTGES3 recombinant protein

Cytosolic prostaglandin synthase that catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). Molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes. Facilitates HIF alpha proteins hydroxylation via interaction with EGLN1/PHD2, leading to recruit EGLN1/PHD2 to the HSP90 pathway.

Product Categories/Family for PTGES3 recombinant protein

Cancer

References

"Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line." Giorgianni F., Zhao Y., Desiderio D.M., Beranova-Giorgianni S. Electrophoresis 28:2027-2034(2007).

NCBI and Uniprot Product Information

• NCBI GI #: 23308579
• NCBI GeneID: 10728
• NCBI Accession #: NP_006592.3
• NCBI GenBank Nucleotide #: NM_006601.7
• UniProt Accession #: Q15185
• Molecular Weight: 21.2 kDa
• NCBI Official Full Name: prostaglandin E synthase 3 isoform a
• NCBI Official Synonym Full Names: prostaglandin E synthase 3
• NCBI Official Symbol: PTGES3
• NCBI Official Synonym Symbols: P23; TEBP; cPGES
• NCBI Protein Information: prostaglandin E synthase 3
• UniProt Protein Name: Prostaglandin E synthase 3
• Protein Family: Prostaglandin E synthase
• UniProt Gene Name: PTGES3
• UniProt Synonym Gene Names: P23; TEBP; cPGES
• UniProt Entry Name: TEBP_HUMAN

NCBI Description

This gene encodes an enzyme that converts prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). This protein functions as a co-chaperone with heat shock protein 90 (HSP90), localizing to response elements in DNA and disrupting transcriptional activation complexes. Alternative splicing results in multiple transcript variants. There are multiple pseudogenes of this gene on several different chromosomes. [provided by RefSeq, Feb 2016]

Uniprot Description

TEBP: Molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts receptor- mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes. Belongs to the p23/wos2 family.

Protein type: Transferase; Isomerase; Chaperone; Nuclear receptor co-regulator; EC 5.3.99.3

Chromosomal Location of Human Ortholog: 12q13.3|12

Cellular Component: nucleoplasm; chromosome, telomeric region; telomerase holoenzyme complex; cytoplasm; nucleus; cytosol

Molecular Function: telomerase activity; protein binding; unfolded protein binding; prostaglandin-E synthase activity

Biological Process: RNA-dependent DNA replication; cyclooxygenase pathway; arachidonic acid metabolic process; prostaglandin biosynthetic process; signal transduction; telomere maintenance