Prostaglandin E2 receptor EP1 subtype (Ptger1) Recombinant Protein | Ptger1 recombinant protein
Recombinant Rat Prostaglandin E2 receptor EP1 subtype (Ptger1)
Gene Names
Ptger1; EP1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Prostaglandin E2 receptor EP1 subtype (Ptger1); Recombinant Rat Prostaglandin E2 receptor EP1 subtype (Ptger1); Ptger1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-405aa; Full length protein
Sequence
MSPYGLNLSLVDEATTCVTPRVPNTSVVLPTGGNGTSPALPIFSMTLGAVSNVLALALLA QVAGRLRRRRSTATFLLFVASLLAIDLAGHVIPGALVLRLYTAGRAPAGGACHFLGGCMV FFGLCPLLLGCGMAVERCVGVTQPLIHAARVSVARARLALALLAAMALAVALLPLVHVGH YELQYPGTWCFISLGPPGGWRQALLAGLFAGLGLAALLAALVCNTLSGLALLRARWRRRR SRRFRENAGPDDRRRWGSRGLRLASASSASSITSTTAALRSSRGGGSARRVHAHDVEMVG QLVGIMVVSCICWSPLLVLVVLAIGGWNSNSLQRPLFLAVRLASWNQILDPWVYILLRQA MLRQLLRLLPLRVSAKGGPTELSLTKSAWEASSLRSSRHSGFSHL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Ptger1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38,498 Da
NCBI Official Full Name
prostaglandin E2 receptor EP1 subtype
NCBI Official Synonym Full Names
prostaglandin E receptor 1
NCBI Official Symbol
Ptger1
NCBI Official Synonym Symbols
EP1
NCBI Protein Information
prostaglandin E2 receptor EP1 subtype
UniProt Protein Name
Prostaglandin E2 receptor EP1 subtype
Protein Family
UniProt Gene Name
Ptger1
UniProt Synonym Gene Names
PGE receptor EP1 subtype; PGE2 receptor EP1 subtype
UniProt Entry Name
PE2R1_RAT
NCBI Description
binds prostaglandin E2; plays a role in G-protein coupled receptor signaling and Ca2+ mobilization [RGD, Feb 2006]
Uniprot Description
PTGER1: Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(q) proteins which activate a phosphatidylinositol-calcium second messenger system. May play a role as an important modulator of renal function. Implicated the smooth muscle contractile response to PGE2 in various tissues. Belongs to the G-protein coupled receptor 1 family.
Protein type: GPCR, family 1; Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass
Cellular Component: integral to membrane; plasma membrane
Molecular Function: prostaglandin E receptor activity
Biological Process: G-protein coupled receptor protein signaling pathway; response to lipopolysaccharide
Research Articles on Ptger1
Similar Products
Product Notes
The Ptger1 ptger1 (Catalog #AAA7028194) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-405aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Ptger1 ptger1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSPYGLNLSL VDEATTCVTP RVPNTSVVLP TGGNGTSPAL PIFSMTLGAV SNVLALALLA QVAGRLRRRR STATFLLFVA SLLAIDLAGH VIPGALVLRL YTAGRAPAGG ACHFLGGCMV FFGLCPLLLG CGMAVERCVG VTQPLIHAAR VSVARARLAL ALLAAMALAV ALLPLVHVGH YELQYPGTWC FISLGPPGGW RQALLAGLFA GLGLAALLAA LVCNTLSGLA LLRARWRRRR SRRFRENAGP DDRRRWGSRG LRLASASSAS SITSTTAALR SSRGGGSARR VHAHDVEMVG QLVGIMVVSC ICWSPLLVLV VLAIGGWNSN SLQRPLFLAV RLASWNQILD PWVYILLRQA MLRQLLRLLP LRVSAKGGPT ELSLTKSAWE ASSLRSSRHS GFSHL. It is sometimes possible for the material contained within the vial of "Prostaglandin E2 receptor EP1 subtype (Ptger1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
