UPF0761 membrane protein PsycPRwf_0630 Recombinant Protein | PsycPRwf_0630 recombinant protein
Recombinant Psychrobacter sp. UPF0761 membrane protein PsycPRwf_0630 (PsycPRwf_0630)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
UPF0761 membrane protein PsycPRwf_0630; Recombinant Psychrobacter sp. UPF0761 membrane protein PsycPRwf_0630 (PsycPRwf_0630); PsycPRwf_0630 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-538aa; full length protein
Sequence
MEKLLKKLPFYDHTWFNFLRFLIGNFIKDDGQQKAASLTYTTLLSIVPILTVLLMILSSV PALESVREQISNIIYSNLLPQSGLQVSEYINNFAEKSSNLTAIGALALFVTTIMTLTTIE RAFNQIWRVEDRSGGIKSIVRYWTIITLGPLVLGTAFLVSSAVQSLSFLNQQVAGYGIDW GFWVQVVSFAVTIAGFIGMYWFIPKAKVPLKNAAIAGVFVAVTFELLKYSFGIIMSNFTS YEAIYGAFAALPIFLLWIYLSWNLILLGVEISYTLTIFATSEVYPRHPLLSLLDMLNLVH DRYQQGKDTSEEDLRSVLGRKELPKWFTYLNYLKDAHLITETDEGNYVLKKDLDNITLWE FYRTLPYPLPIKDELDEVCANARTPWLSLLVQRFVQTEKHARQELDIPLAKIFAHSLPRE KVEVSHSVFSAQDADAKRTTSQSTTAEGGRQSAAEDGKFDAQPFDPNADVLPDSDSKEAT NPPDADIKAAAAKGTVNSAQHSKHTETAKQEHKKTGLLGLFSHDKDAPIITEDDNPNK
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Psychrobacter sp. (strain PRwf-1)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for PsycPRwf_0630 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60,324 Da
NCBI Official Full Name
membrane protein
UniProt Protein Name
UPF0761 membrane protein PsycPRwf_0630
Protein Family
UniProt Gene Name
PsycPRwf_0630
UniProt Entry Name
Y630_PSYWF
Uniprot Description
Enzyme and pathway databasesBioCyc Collection of Pathway/Genome Databases<br/><a href='/database/5'>More..</a>BioCyciPSP349106:G12XP-639-MONOMER.
Similar Products
Product Notes
The UPF0761 membrane protein PsycPRwf_0630 psycprwf_0630 (Catalog #AAA7039413) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-538aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the UPF0761 membrane protein PsycPRwf_0630 psycprwf_0630 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEKLLKKLPF YDHTWFNFLR FLIGNFIKDD GQQKAASLTY TTLLSIVPIL TVLLMILSSV PALESVREQI SNIIYSNLLP QSGLQVSEYI NNFAEKSSNL TAIGALALFV TTIMTLTTIE RAFNQIWRVE DRSGGIKSIV RYWTIITLGP LVLGTAFLVS SAVQSLSFLN QQVAGYGIDW GFWVQVVSFA VTIAGFIGMY WFIPKAKVPL KNAAIAGVFV AVTFELLKYS FGIIMSNFTS YEAIYGAFAA LPIFLLWIYL SWNLILLGVE ISYTLTIFAT SEVYPRHPLL SLLDMLNLVH DRYQQGKDTS EEDLRSVLGR KELPKWFTYL NYLKDAHLIT ETDEGNYVLK KDLDNITLWE FYRTLPYPLP IKDELDEVCA NARTPWLSLL VQRFVQTEKH ARQELDIPLA KIFAHSLPRE KVEVSHSVFS AQDADAKRTT SQSTTAEGGR QSAAEDGKFD AQPFDPNADV LPDSDSKEAT NPPDADIKAA AAKGTVNSAQ HSKHTETAKQ EHKKTGLLGL FSHDKDAPII TEDDNPNK. It is sometimes possible for the material contained within the vial of "UPF0761 membrane protein PsycPRwf_0630, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
