Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Proteasome activator complex subunit 1 (PSME1) Recombinant Protein | PSME1 recombinant protein

Recombinant Bovine Proteasome activator complex subunit 1 (PSME1)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Proteasome activator complex subunit 1 (PSME1); Recombinant Bovine Proteasome activator complex subunit 1 (PSME1); PSME1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-249, full length protein
Sequence
MATLRVLPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPDLNEANLSNLKAPLDIPVPDPVKEKEKEERRKQQEKEDKDEKKKGEDEDKGPPCGPVGCNEKIVVLLQRVKPEIKDVIEKLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTALHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY
Sequence Length
249
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for PSME1 recombinant protein
The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP
ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the alpha subunit of the 11S regulator, one of the two 11S subunits that is induced by gamma-interferon. Three alpha and three beta subunits combine to form a heterohexameric ring. Two transcripts encoding different isoforms have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
28,663 Da
NCBI Official Full Name
Proteasome activator complex subunit 1
NCBI Official Synonym Full Names
proteasome activator subunit 1
NCBI Official Symbol
PSME1
NCBI Protein Information
proteasome activator complex subunit 1
UniProt Protein Name
Proteasome activator complex subunit 1
UniProt Gene Name
PSME1
UniProt Synonym Gene Names
PA28a; PA28alpha

Uniprot Description

Implicated in immunoproteasome assembly and required for efficient antigen processing. The PA28 activator complex enhances the generation of class I binding peptides by altering the cleavage pattern of the proteasome.

Similar Products

Product Notes

The PSME1 psme1 (Catalog #AAA1424101) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-249, full length protein. The amino acid sequence is listed below: MATLRVLPEA QAKVDVFRED LCTKTENLLG SYFPKKISEL DAFLKEPDLN EANLSNLKAP LDIPVPDPVK EKEKEERRKQ QEKEDKDEKK KGEDEDKGPP CGPVGCNEKI VVLLQRVKPE IKDVIEKLNL VTTWLQLQIP RIEDGNNFGV AVQEKVFELM TALHTKLEGF HTQISKYFSE RGDAVTKAAK QPHVGDYRQL VHELDEAEYR DIRLMVMEIR NAYAVLYDII LKNFEKLKKP RGETKGMIY. It is sometimes possible for the material contained within the vial of "Proteasome activator complex subunit 1 (PSME1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.