Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Proteasome subunit beta type-8 (PSMB8) Recombinant Protein | PSMB8 recombinant protein

Recombinant Human Proteasome subunit beta type-8 (PSMB8)

Gene Names
PSMB8; JMP; ALDD; LMP7; NKJO; D6S216; PSMB5i; RING10; D6S216E
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Proteasome subunit beta type-8 (PSMB8); Recombinant Human Proteasome subunit beta type-8 (PSMB8); Proteasome subunit beta type-8; EC=3.4.25.1; Low molecular mass protein 7; Macropain subunit C13; Multicatalytic endopeptidase complex subunit C13; Proteasome component C13; Proteasome subunit beta-5i; Really interesting new gene 10 protein; PSMB8 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
73-276aa; Full Length of Mature Protein
Sequence
TTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ
Sequence Length
204
Species
Homo sapiens (Human)
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-Page

SDS-Page
Related Product Information for PSMB8 recombinant protein
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides. Replacement of PSMB5 by PSMB8 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues. Acts as a major component of interferon gamma-induced sensitivity. Plays a key role in apoptosis via the degradation of the apoptotic inhibitor MCL1. May be involved in the inflammatory response pathway. In cancer cells, substitution of isoform 1 (E2) by isoform 2 (E1) results in immunoproteasome deficiency. Required for the differentiation of preadipocytes into adipocytes.
Product Categories/Family for PSMB8 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42.7 kDa
NCBI Official Full Name
proteasome subunit beta type-8 isoform E1 proprotein
NCBI Official Synonym Full Names
proteasome (prosome, macropain) subunit, beta type, 8
NCBI Official Symbol
PSMB8
NCBI Official Synonym Symbols
JMP; ALDD; LMP7; NKJO; D6S216; PSMB5i; RING10; D6S216E
NCBI Protein Information
proteasome subunit beta type-8; macropain subunit C13; proteasome subunit Y2; protease component C13; proteasome component C13; proteasome-related gene 7; proteasome subunit beta 5i; low molecular mass protein 7; low molecular weight protein 7; proteasome catalytic subunit 3i; large multifunctional peptidase 7; really interesting new gene 10 protein; multicatalytic endopeptidase complex subunit C13; proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7)
UniProt Protein Name
Proteasome subunit beta type-8
Protein Family
UniProt Gene Name
PSMB8
UniProt Synonym Gene Names
LMP7; PSMB5i; RING10; Y2
UniProt Entry Name
PSB8_HUMAN

NCBI Description

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is located in the class II region of the MHC (major histocompatibility complex). Expression of this gene is induced by gamma interferon and this gene product replaces catalytic subunit 3 (proteasome beta 5 subunit) in the immunoproteasome. Proteolytic processing is required to generate a mature subunit. Two alternative transcripts encoding two isoforms have been identified; both isoforms are processed to yield the same mature subunit. [provided by RefSeq, Jul 2008]

Uniprot Description

PSMB8: a proteasomal protein of the T1B peptidase family. The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. Expression of this gene is induced by gamma interferon and this gene product replaces catalytic subunit 3 (proteasome beta 5 subunit) in the immunoproteasome. Proteolytic processing is required to generate a mature subunit. Two alternatively spliced isoforms have been identified; both isoforms are processed to yield the same mature subunit.

Protein type: EC 3.4.25.1; Protease; Proteasome complex

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: proteasome complex; nucleoplasm; proteasome core complex; cytosol

Molecular Function: threonine endopeptidase activity; protein binding

Biological Process: positive regulation of ubiquitin-protein ligase activity during mitotic cell cycle; fat cell differentiation; negative regulation of ubiquitin-protein ligase activity during mitotic cell cycle; protein polyubiquitination; viral reproduction; apoptosis; cytokine and chemokine mediated signaling pathway; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; regulation of apoptosis; antigen processing and presentation of peptide antigen via MHC class I; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; antigen processing and presentation of exogenous peptide antigen via MHC class I; gene expression; mitotic cell cycle; regulation of amino acid metabolic process; negative regulation of apoptosis; G1/S transition of mitotic cell cycle

Disease: Autoinflammation, Lipodystrophy, And Dermatosis Syndrome

Research Articles on PSMB8

Similar Products

Product Notes

The PSMB8 psmb8 (Catalog #AAA961824) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 73-276aa; Full Length of Mature Protein. The amino acid sequence is listed below: TTTLAFKFQH GVIAAVDSRA SAGSYISALR VNKVIEINPY LLGTMSGCAA DCQYWERLLA KECRLYYLRN GERISVSAAS KLLSNMMCQY RGMGLSMGSM ICGWDKKGPG LYYVDEHGTR LSGNMFSTGS GNTYAYGVMD SGYRPNLSPE EAYDLGRRAI AYATHRDSYS GGVVNMYHMK EDGWVKVEST DVSDLLHQYR EANQ. It is sometimes possible for the material contained within the vial of "Proteasome subunit beta type-8 (PSMB8), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.