Proteasome subunit beta type-4 Recombinant Protein | PSMB4 recombinant protein

Recombinant human Proteasome subunit beta type-4

Cat. Num. AAA717279

• Gene Names: PSMB4; HN3; HsN3; PROS26; PROS-26
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Proteasome subunit beta type-4; Recombinant human Proteasome subunit beta type-4; Recombinant human Proteasome subunit beta type-4 protein; PSMB4 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence: TQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE

• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.

SDS-PAGE

Related Product Information for PSMB4 recombinant protein

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Mediates the lipopolysaccharide-induced signal macrophage proteasome By similarity. SMAD1/OAZ1/PSMB4 complex mediates the degradation of the CREBBP/EP300 repressor SNIP1.

References

[1] "Sequence analyses and inter-species comparisons of three novel human proteasomal subunits, HsN3, HsC7-I and HsC10-II, confine potential proteolytic active-site residues."

NCBI and Uniprot Product Information

• NCBI GI #: 22538466
• NCBI GeneID: 5692
• NCBI Accession #: NP_002787.2
• NCBI GenBank Nucleotide #: NM_002796.2
• UniProt Accession #: P28070; P31148; Q5SZS5; Q6IBI4; Q969L6; B2R9L3
• Molecular Weight: 51 KD
• NCBI Official Full Name: Homo sapiens proteasome (prosome, macropain) subunit, beta type, 4 (PSMB4), mRNA
• NCBI Official Synonym Full Names: proteasome (prosome, macropain) subunit, beta type, 4
• NCBI Official Symbol: PSMB4
• NCBI Official Synonym Symbols: HN3; HsN3; PROS26; PROS-26
• NCBI Protein Information: proteasome subunit beta type-4; hsBPROS26; proteasome chain 3; macropain beta chain; proteasome beta chain; 26 kDa prosomal protein; proteasome subunit HsN3; proteasome subunit, beta type, 4; multicatalytic endopeptidase complex beta chain
• UniProt Protein Name: Proteasome subunit beta type-4
• Protein Family: Proteasome
• UniProt Gene Name: PSMB4
• UniProt Synonym Gene Names: PROS26; Proteasome beta chain; HsBPROS26; PROS-26; HsN3
• UniProt Entry Name: PSB4_HUMAN

NCBI Description

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Mediates the lipopolysaccharide-induced signal macrophage proteasome

By similarity. SMAD1/OAZ1/PSMB4 complex mediates the degradation of the CREBBP/EP300 repressor SNIP1. Ref.15

Catalytic activity: Cleavage of peptide bonds with very broad specificity.

Subunit structure: The 26S proteasome consists of a 20S proteasome core and two 19S regulatory subunits. The 20S proteasome core is composed of 28 subunits that are arranged in four stacked rings, resulting in a barrel-shaped structure. The two end rings are each formed by seven alpha subunits, and the two central rings are each formed by seven beta subunits. The catalytic chamber with the active sites is on the inside of the barrel. Interacts with HIV-1 TAT and HIV-1 NEF proteins. Interaction with HTLV-1 TAX protein favors NFKB1 activation. Interacts with bacterial lipopolysaccharide (LPS)

By similarity. Forms a ternary complex with SMAD1 and OAZ1 before PSMB4 is incorporated into the 20S proteasome. Interacts with PRPF19. Ref.12 Ref.13 Ref.16 Ref.17

Subcellular location: Cytoplasm

By similarity. Nucleus

By similarity.

Induction: Up-regulated in fibrolamellar carcinomas. Ref.20

Sequence similarities: Belongs to the peptidase T1B family.