Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Photosystem Q (B) protein Recombinant Protein | psbA recombinant protein

Recombinant Prochlorococcus marinus Photosystem Q (B) protein

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Photosystem Q (B) protein; Recombinant Prochlorococcus marinus Photosystem Q (B) protein; Recombinant Photosystem Q (B) protein; Photosystem Q(B) protein EC= 1.10.3.9; 32 kDa thylakoid membrane protein Photosystem II protein D1; psbA recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-345
Sequence
MTTIQQQRSSLLKGWPQFCEWVTSTNNRIYVGWFGVLMIPCLLTAAACFIVAFIAAPPVDIDGIREPVAGSFLYGNNIISGAVVPSSNAIGLHFYPIWEAATVDEWLYNGGPYQLVIFHFLIGISAYMGRQWELSYRLGMRPWICVAYSAPVSAAFAVFLVYPFGQGSFSDGMPLGISGTFNFMFVFQAEHNILMHPFHMAGVAGMFGGSLFSAMHGSLVTSSLIRETTETESQNYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAVFPVVCVWLTSMGICTMAFNLNGFNFNQSVVDANGKIVPTWGDVLNRANLGMEVMHERNAHNFPLDLA
Sequence Length
360
Species
Prochlorococcus marinus (strain MIT 9215)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,638 Da
NCBI Official Full Name
hypothetical protein P9215_13011
NCBI Official Symbol
psbA
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Photosystem Q(B) protein
Protein Family
UniProt Gene Name
psbA
UniProt Entry Name
PSBA_PROM2

Uniprot Description

Function: This is one of the two reaction center proteins of photosystem II

By similarity. HAMAP-Rule MF_01379

Catalytic activity: 2 H2O + 2 plastoquinone + 4 light = O2 + 2 plastoquinol. HAMAP-Rule MF_01379

Cofactor: The PsbA/B heterodimer binds P680, the primary electron donor of PSII. It shares a non-heme iron and each subunit binds additional chlorophylls and pheophytin. PsbA provides most of the ligands for the Mn-cluster of the oxygen-evolving complex

By similarity.

Subunit structure: The PsbA/B heterodimer binds the P680 chlorophylls and subsequent electron acceptors. PSII consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. PSII forms dimeric complexes

By similarity.

Subcellular location: Cellular thylakoid membrane; Multi-pass membrane protein

By similarity HAMAP-Rule MF_01379.

Miscellaneous: Herbicides such as atrazine, BNT, diuron or ioxynil bind to Q(B) and block electron transport

By similarity. HAMAP-Rule MF_01379Cyanobacteria usually contain more than 2 copies of the psbA gene. HAMAP-Rule MF_01379

Sequence similarities: Belongs to the reaction center PufL/M/PsbA/D family.

Sequence caution: The sequence ABV50916.1 differs from that shown. Reason: Erroneous initiation.

Similar Products

Product Notes

The psbA psba (Catalog #AAA1225406) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-345. The amino acid sequence is listed below: MTTIQQQRSS LLKGWPQFCE WVTSTNNRIY VGWFGVLMIP CLLTAAACFI VAFIAAPPVD IDGIREPVAG SFLYGNNIIS GAVVPSSNAI GLHFYPIWEA ATVDEWLYNG GPYQLVIFHF LIGISAYMGR QWELSYRLGM RPWICVAYSA PVSAAFAVFL VYPFGQGSFS DGMPLGISGT FNFMFVFQAE HNILMHPFHM AGVAGMFGGS LFSAMHGSLV TSSLIRETTE TESQNYGYKF GQEEETYNIV AAHGYFGRLI FQYASFNNSR SLHFFLAVFP VVCVWLTSMG ICTMAFNLNG FNFNQSVVDA NGKIVPTWGD VLNRANLGME VMHERNAHNF PLDLA. It is sometimes possible for the material contained within the vial of "Photosystem Q (B) protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.