Photosystem I reaction center subunit III (psaF) Recombinant Protein | Ava_1478 recombinant protein
Recombinant Anabaena variabilis Photosystem I reaction center subunit III (psaF)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Photosystem I reaction center subunit III (psaF); Recombinant Anabaena variabilis Photosystem I reaction center subunit III (psaF); Ava_1478 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
24-164
Sequence
LGADLTPCAENPAFQALAKNARNTTADPQSGQKRFERYSQALCGPEGYPHLIVDGRLDRAGDFLIPSILFLYIAGWIGWVGRAYLQAIKKDSDTEQKEIQLDLGLALPIIATGFAWPAAAVKELLSGELTAKDSEITVSPR
Sequence Length
164
Species
Anabaena variabilis (strain ATCC 29413 / PCC 7937)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for Ava_1478 recombinant protein
psaF
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,833 Da
NCBI Official Full Name
photosystem I reaction center protein PsaF subunit III
NCBI Official Symbol
Ava_1478
NCBI Protein Information
photosystem I reaction center protein PsaF subunit III
UniProt Protein Name
Photosystem I reaction center subunit III
UniProt Gene Name
psaF
UniProt Entry Name
PSAF_ANAVT
Uniprot Description
Function: Probably participates in efficiency of electron transfer from plastocyanin to P700 (or cytochrome c553 in algae and cyanobacteria). This plastocyanin-docking protein contributes to the specific association of plastocyanin to PSI.
Subcellular location: Cellular thylakoid membrane; Multi-pass membrane protein
By similarity.
Sequence similarities: Belongs to the PsaF family.
Similar Products
Product Notes
The Ava_1478 psaf (Catalog #AAA1171867) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-164. The amino acid sequence is listed below: LGADLTPCAE NPAFQALAKN ARNTTADPQS GQKRFERYSQ ALCGPEGYPH LIVDGRLDRA GDFLIPSILF LYIAGWIGWV GRAYLQAIKK DSDTEQKEIQ LDLGLALPII ATGFAWPAAA VKELLSGELT AKDSEITVSP R. It is sometimes possible for the material contained within the vial of "Photosystem I reaction center subunit III (psaF), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
