Photosystem I iron-sulfur center (psaC) Recombinant Protein | psaC recombinant protein
Recombinant Phalaenopsis aphrodite subsp. formosana Photosystem I iron-sulfur center (psaC)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Photosystem I iron-sulfur center (psaC); Recombinant Phalaenopsis aphrodite subsp. formosana Photosystem I iron-sulfur center (psaC); psaC recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-81, Full length protein
Sequence
SHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLSY
Sequence Length
80
Species
Phalaenopsis aphrodite subsp. formosana (Moth orchid)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
9,054 Da
NCBI Official Full Name
photosystem I subunit VII (chloroplast)
NCBI Official Symbol
psaC
NCBI Protein Information
photosystem I iron-sulfur center
UniProt Protein Name
Photosystem I iron-sulfur center
Protein Family
UniProt Gene Name
psaC
Uniprot Description
Apoprotein for the two 4Fe-4S centers FA and FB of photosystem I (PSI); essential for photochemical activity. FB is the terminal electron acceptor of PSI, donating electrons to ferredoxin. The C-terminus interacts with PsaA/B/D and helps assemble the protein into the PSI complex. Required for binding of PsaD and PsaE to PSI. PSI is a plastocyanin-ferredoxin oxidoreductase, converting photonic excitation into a charge separation, which transfers an electron from the donor P700 chlorophyll pair to the spectroscopically characterized acceptors A0, A1, FX, FA and FB in turn.
Similar Products
Product Notes
The psaC psac (Catalog #AAA1365631) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-81, Full length protein. The amino acid sequence is listed below: SHSVKIYDTC IGCTQCVRAC PTDVLEMIPW DGCKAKQIAS APRTEDCVGC KRCESACPTD FLSVRVYLWH ETTRSMGLSY. It is sometimes possible for the material contained within the vial of "Photosystem I iron-sulfur center (psaC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
